KEGG   Niastella koreensis: Niako_2922Help
Entry
Niako_2922        CDS       T01679                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
nko  Niastella koreensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Niako_2922
Enzymes [BR:nko01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Niako_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3662043..3663563
Genome map
AA seq 506 aa AA seqDB search
MSIPKIKTLGELKKSGYQPKSVKDEIRKNLICKLQKQESTFNGIIGYEETVIPDVERALL
SRHNILFLGLRGQAKTRMARQMIELLDEYIPVIEGTEINDDPLNPISIHAKDLIAQYGDD
TPIHWVHRSERYGEKLATPDVSVADLIGDIDPIKAANLRLSFADERVIHYGIIPRSNRGI
FVINEIPDLQARIQVALFNILEEGDVQIRGFKLRMPLDILFVFTANPEDYTNRGSIVTPL
KDRIESQILTHYPKTIETALTITEQEADILKEQEAKVKMSDLIKRLIEQISFEARSSELV
DKKSGVSARLSISAFENAVSSAERRALINKENNTQVWISDLIGLIPSITGKIELVYEGEQ
EGPYQVAMNLLDKAIRSQFIQYFPNPETLKKKRNQQAAEENPYRSISSWFDKGNSLNLLF
HTKDEDKIQQLYKVDGLHALVKKYFKQANEKDAALLMEFVLHGLAAFSMISKKILESRIE
FKDLMGSMLGNATSFGEEELDSDDFN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcataccaaaaataaaaaccctgggcgaacttaagaagagtggctatcaaccaaag
tcagtaaaagatgagatcaggaagaacctaatttgcaaattacaaaagcaggaaagcacc
tttaacgggatcataggctatgaagaaacagttatacccgatgtagaaagggcgcttctg
tcgcgtcacaacattttattccttggtttgcgcggacaggcaaaaacgcgtatggcccgg
caaatgattgaattactcgatgaatacatcccggtgatcgaaggtactgagatcaacgac
gatccgttgaatcccatttccatccacgccaaagacctgattgcgcaatatggcgacgac
actcccatccactgggtacatcgcagtgaacgttatggcgaaaagctcgcaacgcccgat
gtaagcgtggctgaccttattggcgacattgatcccattaaagcagctaatttgcggtta
agctttgccgatgaacgcgtgatccactatggtattatcccccgcagtaaccgcggcatt
ttcgttatcaacgaaattcccgacttacaagcccgcatccaggtagctttgttcaatatc
ctggaagaaggcgatgtacagatccgcggtttcaaactgcgcatgccgttggatatctta
tttgtattcacggccaacccggaagactataccaaccgcggttctattgtaaccccgttg
aaagaccggatcgagagccagatcctgacgcactatcccaaaaccatcgaaactgccctt
acgattaccgagcaggaagccgatattttgaaggaacaggaagcgaaggtgaaaatgagc
gatctgataaaacgactgatcgagcagatctcgtttgaagcccgctccagcgaactggtt
gataagaaaagcggcgtatcggcccggttaagcatctctgcatttgaaaatgccgtgagc
tctgccgagcgccgtgcattgatcaataaagaaaacaacacgcaggtatggatcagcgat
ctgattggcctgatcccttctattaccggtaaaattgaactggtgtatgaaggcgagcag
gaaggcccataccaggtagccatgaacctgctcgataaagccatccggtcacaattcatt
caatactttcccaatccggaaacattgaagaagaaacgcaatcaacaggcagccgaagaa
aatccttatcgttccatctcaagctggttcgacaaaggcaattcattaaacctgttgttc
catacaaaggacgaagacaaaatacagcagctgtataaggtagatggcctgcatgcactg
gtgaaaaagtattttaaacaggccaatgaaaaagacgccgcgctgttaatggagtttgta
ttacacggcctggccgccttttccatgatcagtaaaaagattctggaaagccgcatcgag
ttcaaagacctgatgggttccatgctgggcaatgccacttcatttggcgaggaagaatta
gacagtgatgattttaattaa

DBGET integrated database retrieval system