KEGG   Niastella koreensis: Niako_2956Help
Entry
Niako_2956        CDS       T01679                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nko  Niastella koreensis
Brite
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Niako_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3720155..3721189)
Genome map
AA seq 344 aa AA seqDB search
MKIIITISGLLFVLLAATPTPLPFVVPPKWPKPKYDFTKNPLTREGFLLGRKLFYDERLS
VDSTISCGSCHQQFAAFSTYEHNLSHGVNSSLTTRNAPALQNLAWQSEFMWDGGIAHLDL
QPLMPLTAPNEMGETLAGVIRKLQQDAAYQKMFRAAFGSEGINTQRVTRALSQYMLMLVS
SNSKYDQVLRGEATFLLPEQLGYDIFKQKCSSCHKEPFFTDLSYRNTGLSVDNTLNDYGR
MAITGNPADSLKFKVPSLRNVMVTFPYGHDGRFFSLLNVFEHYRRDMTVSATTDSLLQHK
MPLTNYEIGQLTAFLQTLTDSSFLKNSMLAPEGNLQLPPQMHIH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatcattaccatatcagggttattgtttgtattgttagctgctacacccacg
ccattgccattcgtggttcctcccaaatggccaaaaccgaaatacgatttcacaaagaac
ccgcttacccgcgaaggttttttgctgggccggaaactgttttacgatgaacgtttaagt
gttgattcaactatttcctgtggcagttgccatcagcaattcgccgcgttttcaacatat
gaacacaacctcagtcatggcgtaaacagttccctcaccactcgtaatgcgcctgcattg
caaaacctggcctggcaaagcgaatttatgtgggatggcggtattgcccatctcgatctg
caaccgctgatgccattaaccgcacccaatgaaatgggtgaaacactggcaggtgttatc
cgcaagctgcaacaggatgccgcctatcagaaaatgttcagggctgcatttggcagtgaa
ggcatcaatacgcaacgggttacccgggcattgagccagtacatgctgatgctggtgagc
agcaacagcaaatacgaccaggtgctgcgcggagaagcaacctttctgttacccgagcag
ctgggctacgacatctttaaacagaaatgcagctcctgtcataaagagccgttctttacg
gatttgtcgtaccgaaataccggcttatccgttgataacaccctgaatgactatgggcga
atggccattaccggtaatccggctgattcattgaagtttaaagtgccctccctgcgtaat
gtgatggtgacttttccctatgggcacgatggccgttttttctccctgctgaatgttttt
gagcattaccggcgggatatgacagtgtctgcaacaactgattccctgttacagcacaaa
atgccgctcaccaattacgagatcgggcaattgaccgcctttctgcaaacgttgactgat
tccagttttttaaagaactccatgctggcgccggagggcaatttgcaattgccaccccaa
atgcacatacattga

DBGET integrated database retrieval system