KEGG   Niastella koreensis: Niako_3295Help
Entry
Niako_3295        CDS       T01679                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nko  Niastella koreensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4175828..4176880
Genome map
AA seq 350 aa AA seqDB search
MKRTLLGFFAIVLIFSCKQNSRDQKPALTKQSEDSLIQLAQKTFKILPVTAESKTNPLTP
EKIKLGKILFFDVRLSKSGNNSCNSCHNLETYGVDNEATSVGDAGKHGGRNSPTVYNAAL
QNMQFWDGRAVDVEEQAGMPILNPVEMAIPHKGFLINRLSAIKLYQDLFKDAFPGEKKPI
TYENLQKAIGAFERTLLTPSRFDKYMAGDTNAITMEEKSGLRVFVQSGCTGCHNGVGVGG
GTLQKFGLVTDYRTLTNSQMSDEGKKQVTHKEQDKDVFKVPELRNVEGTHPYFHDGSIAR
LDTAVKIMGKAQLNKDLSATEIKQVVAFLNALSGQINPAYKTFPEELNRH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacattattgggctttttcgcaattgtgctgattttttcttgcaaacaaaac
agcagggatcaaaagcctgcgttaaccaaacagtcggaagattcgctcattcaactggca
caaaaaacgttcaaaatactgccagttaccgcagaaagcaagaccaatccattgacccca
gaaaaaattaagcttggtaagatattgtttttcgacgtcaggctttcaaaatcaggtaac
aacagttgtaactcctgccataacctggaaacgtacggtgtagataatgaggccacttct
gtaggcgatgccggtaagcatggtggaagaaattcacctacggtttataatgcagcttta
cagaacatgcagttttgggacggccgggctgtggatgtagaggaacaggccggtatgccc
attttaaatccggttgaaatggccattcctcacaaaggttttttgataaacaggttaagc
gcaattaaattataccaggaccttttcaaggatgcatttcccggcgaaaaaaaaccaatt
acatacgagaaccttcaaaaagcgattggcgcctttgagcgtacacttctaactccatcc
cgctttgataaatacatggcaggcgatacgaatgctatcacaatggaagaaaaatcgggg
ctgagggttttcgtgcaatcgggatgcaccggttgccataacggtgttggggttggcggc
ggaactttacaaaaattcggcctggtaaccgattaccgcacgctaaccaatagccaaatg
agtgatgaagggaaaaagcaggtaacccataaagaacaggataaggacgtgtttaaagta
cccgagttgcgcaacgttgaaggaacacacccctattttcacgatggaagtatcgccagg
cttgatacggcggtaaagatcatgggtaaggcccagctaaacaaggacctctcagctact
gagataaagcaggtggtggcttttttaaatgcattatcaggccagatcaatcctgcctat
aaaactttcccggaagagttgaacaggcattga

DBGET integrated database retrieval system