KEGG   Niastella koreensis: Niako_3540Help
Entry
Niako_3540        CDS       T01679                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
nko  Niastella koreensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Niako_3540
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Niako_3540
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Niako_3540
Enzymes [BR:nko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Niako_3540
Exosome [BR:nko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Niako_3540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4433959..4435824)
Genome map
AA seq 621 aa AA seqDB search
MNKLLFTLLIVLRTTAFSQPANYTVANAHSHNDYEQPVPLLTAYNETFGSIEADIFWYNG
EILVAHSEKELALHRTLEDMYLKPLQSFIEKNKGHIYADAARHLQFMIDIKTDSVTTLNK
LVELLRKYPVLTQCSTLQIAISGNRPEVSAYASYPSFIWFDGELQKEYPAAALARVVMLS
ADLKKYTMWNGKGIIPSPQWDTLQKLVSHAHALNKRVRFWGAPDFTNAWIQLMRLQVDYI
NTDSIKALSDFLRKMPSNSFKNKTGYKPYQPTFLHDGVDKPVKNILLFIGDGTGLAQLYA
GYTANKGALNVFNMRNIGFSKTSSYDCYVTDSAPGSTAFASGEKTNNRHVGVDHTGVAIP
LLPVFLKTKNIKTGLVTCGDITDATPADFYAHQTDRENSIAIIHDLKKADIDLLMGSGRE
SLANVALLEGNVKDAGSDSAFQELSPEFTVVHSVDSVKDVPGKKWVVVDPKAGLPVLRGR
EHWLEQAFSKAVKTLSRNKAGFFLMTEGAQVDYGGHANDLSYVASEVMDFDQVIGKAMQF
ADADGQTLVIVTADHETGGLSLLAGDYSNGYVSGNFSTNDHTATPVPVFAYGPQSFRFRG
VYENTELFYRMMAALNIPIRK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagctactttttactttattgatcgttctcagaacaacagctttctcccaacct
gctaactataccgttgccaatgcgcactcgcacaacgactatgagcagccggttccgctg
ttaacggcctataatgaaacctttggttccatagaggccgatatcttctggtataatggt
gaaatactggtagcgcatagtgaaaaggaactggcattgcaccgaacactggaagatatg
tacctgaaaccgttgcagtcatttatagaaaagaacaagggacatatttatgcagatgcc
gcccggcacctgcagtttatgatagatataaaaaccgacagcgtaactaccctgaacaaa
ctggttgaactgttgcggaaatatcccgtgcttacacagtgttcaactttgcagattgct
atcagtggcaaccggcccgaggtatcggcgtatgcttcttatccttcctttatctggttc
gatggtgaattgcaaaaagagtatccggccgctgcccttgcgcgcgtggtgatgctaagc
gccgatctgaaaaaatataccatgtggaatggaaaaggaattattccttcgccgcaatgg
gatacgctgcaaaaactggtatcacatgcgcatgcactcaacaaacgggttcgtttttgg
ggagcccctgattttaccaatgcctggatccagttgatgcgcctgcaggtggattatatc
aatacagatagcattaaagcattgtcagattttctgcggaaaatgccgtcgaactctttt
aaaaataaaaccgggtataagccttatcaacccacttttctgcatgatggcgttgataaa
ccggtaaagaatattttactgttcattggcgatggtacagggctggcccagttgtatgcc
ggttataccgccaataaaggcgcgctgaatgttttcaacatgcgtaatatcgggttctcc
aaaaccagctcgtacgattgttatgttaccgattcggcccccggttcaacggcctttgct
tccggtgaaaaaaccaataaccggcatgtgggcgtagatcataccggagtagccattccc
ttgctgccggtgtttctgaaaacaaaaaatataaaaaccgggctggttacctgtggggat
attaccgatgccacgccggctgatttctacgcgcatcaaaccgaccgggaaaattctatt
gctatcattcatgatcttaaaaaggccgatatcgatctgctgatgggatcgggcagggag
agtttagcaaatgttgccctgctggaaggaaatgtcaaagacgccggttccgacagcgcc
ttccaggagttgtcgcctgaatttactgttgttcatagtgtggacagcgtgaaagatgta
cctggtaaaaaatgggtggtggttgacccgaaggcgggtttgcccgtgctgcgggggcgg
gagcactggctggaacaggccttctcaaaagcagtgaaaacgttgtcccgcaataaagcg
ggattttttttaatgacggagggcgcgcaggttgattatggcggtcatgccaacgaccta
tcgtatgtagccagcgaggtaatggattttgaccaggtgataggcaaagcgatgcaattt
gctgatgcagacggacaaacacttgttattgtaacagccgatcacgaaaccggtggtttg
tcgctgctggccggcgattattccaatggctatgtaagcggtaatttttccaccaacgac
catactgccacaccggtgccggtgtttgcctatggcccgcaatcgttccgtttcaggggc
gtatatgaaaacacggagttgttttaccgcatgatggcggcgcttaacatcccaataaga
aaataa

DBGET integrated database retrieval system