KEGG   Niastella koreensis: Niako_3708Help
Entry
Niako_3708        CDS       T01679                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nko  Niastella koreensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4666815..4667546
Genome map
AA seq 243 aa AA seqDB search
MKSNTFLTDVTWKVMSVALLMLLITGSSILAGCNKKSSIADTAPAGERLTGYVNENAQPE
STGSNNGYFWSLYREGGSGSITFGNAGNFAISYSNVTDIVGGKGWNPGSARTIGYNVGAL
SGSYNFVGIYGWTTSPLIEYYVAEMGNVTGGSYVNNVSSDGHSYSFYKQQRVNAPSIIGT
ATFWQYKDTWGGSGTGSNRSVNMANHINNWRNSGGQGFGSYNYQILALEAWGNKSGYINA
TVW
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaacactttcctaacggatgtgacctggaaggttatgtccgtcgcccttctc
atgctgctcatcaccggctcctccattctggccggttgtaacaaaaaaagcagcattgcc
gataccgcccctgcgggcgaacgcctcaccggttacgttaacgagaatgcccagcctgaa
tctacaggcagcaacaacgggtatttctggtcgttataccgcgaaggcggctccggcagc
attacttttggcaacgcaggcaatttcgccatcagttacagcaatgttaccgacattgta
ggtggaaaaggctggaaccccggttctgcccggaccattggttataatgtaggcgccctc
agcggcagttataactttgttggcatctatggctggaccaccagtccgctgattgaatac
tatgttgccgaaatgggcaacgtaaccggcggttcctatgtaaacaacgttagcagcgat
ggacattcttacagcttctacaaacagcaacgcgttaacgcaccttctattattggcaca
gcaaccttctggcagtacaaagacacctggggcggctcaggcaccggatcgaaccgttcc
gttaatatggccaaccacatcaacaactggcgcaacagcggcggccagggttttggcagt
tacaattaccagatccttgcgttggaagcatggggtaataaaagtggctacataaacgca
actgtttggtaa

DBGET integrated database retrieval system