KEGG   Niastella koreensis: Niako_4142Help
Entry
Niako_4142        CDS       T01679                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nko  Niastella koreensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Niako_4142
Enzymes [BR:nko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Niako_4142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5205378..5206316
Genome map
AA seq 312 aa AA seqDB search
MRSTVANAGDRNLIVFPNCKINLGLHVVSKREDGYHSLETIFYPLPLRDALEVVKADGPP
TQKLRRARQTADNRESAIVDRQSTEQSGPVGLHLSGLIVQGLTADNLCVKAYNLLKKDFP
QLGDIELYLHKAIPMGAGLGGGSADGAFTLSALNEKFQLNLSSEKLLDYSLQLGSDCPFF
IINKPCYATGRGELLQSIPLDLSTYSFLVVHPGVHINTGWAFSQLSPAPSPQPLPEIIQQ
PVASWRNNLNNDFEAPVCKHHPALQAIKDALYDAGALYASMTGSGSCFYGIFPKNQLPAL
QWPAQYAVFEVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaacagtcgcaaacgcaggggatagaaacttgatagtatttccaaattgtaag
atcaatctcgggcttcatgttgttagcaaacgtgaagatggttaccacagcctggaaacc
attttttacccgttgcctttaagggatgcgttggaagtggtgaaggcagacggccctcct
acgcaaaagcttcggcgggcaaggcagacggcagacaatcgtgaatcggcaatcgtggat
cggcaatcgacagaacaatccgggccggtcgggcttcacttaagcggtctgattgtgcag
ggtttgacagcagataatctctgcgttaaagcttacaacttactcaagaaagattttcct
caactaggtgacatcgaactatacctgcacaaggctattcctatgggcgccggactgggt
ggcggttctgccgatggcgcttttaccctatcagcactcaacgagaaatttcaattgaac
ctaagcagcgaaaagctgttggattattccctacaattaggcagtgactgtcccttcttt
atcatcaacaaaccctgctatgcaacaggccgcggcgaattgctgcaaagcataccactg
gatctgagtacttattcattcctggtagtgcatccaggagtacacatcaatacaggctgg
gctttttcacaactctcccctgccccatcaccacaacctttacccgaaatcattcaacaa
ccggtagccagctggcgtaataacctcaacaacgattttgaagcgccggtttgtaaacat
catccagccctgcaagccatcaaagatgcattgtatgatgcgggcgccctctatgcctcc
atgacgggcagcggctcctgtttctatggcatatttcctaaaaatcaacttcctgccctg
caatggcctgcccaatacgctgtatttgaggtgaaataa

DBGET integrated database retrieval system