KEGG   Niastella koreensis: Niako_4179Help
Entry
Niako_4179        CDS       T01679                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nko  Niastella koreensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Niako_4179
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Niako_4179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5246615..5247577
Genome map
AA seq 320 aa AA seqDB search
MKKLVSVFILVIIIGSGFAQTVKVNGALKVVGTKLVNEKGQPIILRGMSLGWHNWWPRFY
NAGAINWLQKDWGCTVIRAAIGVEPDSGYIKYPDWGMEKAKTAIDAAIKDGIYIIVDWHS
HHIRQEEAKQFFTKIAKEYGKYANIIYEIFNEPAENTWPEVKAYSIDLIKTIRAIDPDNV
ILVGSPHWDQDVHIVADDPIKGYKNLMYTLHYYADTHKQELRDRGDYALKKGLPLFISEM
GGMSHTGDGPINNPEWMKWIDWSEKNKISWVNWCVTDKKNVTCSVLEPTASSTGPWSMND
LPDWGKQTRSLIRKYNGLRP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattagtttccgtattcattttagtaattattatcggcagcggttttgcccaa
acagtaaaagtaaatggcgcgttgaaagtagtgggtacaaaactggtgaatgaaaaagga
cagccaatcattttgcggggcatgagtttgggctggcacaactggtggccacggttttac
aatgccggcgccatcaactggctgcaaaaagactggggctgtacagttatccgtgcagcc
atcggcgttgaacctgacagcgggtatataaaatatcctgactggggaatggaaaaagca
aaaactgcgatcgatgccgctataaaagacggaatttatattatcgttgactggcacagt
catcacatcaggcaggaggaagccaaacagttcttcactaaaatagcaaaggaatacgga
aagtatgccaatatcatttacgagatctttaatgaacccgcagagaatacctggcccgaa
gtaaaagcgtattctattgatctgataaaaaccatccgggccatcgatccggataatgtg
atcttagtgggctcaccgcattgggaccaggacgtacacattgttgcagacgatcctatc
aagggttataaaaacctgatgtataccttgcactattacgcggacactcacaagcaggag
ctgcgcgaccgaggcgactatgccctgaaaaaaggcttgcccctgtttatctccgaaatg
ggcggtatgtcccataccggtgatggccccatcaataatccggaatggatgaaatggatt
gattggtctgaaaaaaacaagatcagctgggttaactggtgtgtaacggataaaaaaaat
gtaacctgttccgttcttgaacccactgcttcttcaaccgggccctggagtatgaacgat
ttgcctgactggggtaaacaaaccaggtcgctcattagaaaatataatgggttaagacca
tag

DBGET integrated database retrieval system