KEGG   Niastella koreensis: Niako_4417Help
Entry
Niako_4417        CDS       T01679                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nko  Niastella koreensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_4417
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Niako_4417
  Amino acid metabolism
   00310 Lysine degradation
    Niako_4417
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Niako_4417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5524385..5525758
Genome map
AA seq 457 aa AA seqDB search
MALVDLVMPKMGESITEATILKWFKNPGETVKMDEAVLEIATDKVDSEVPSVAEGVIEET
FFKVNDVVPVGTVLARIRSNAAEPATTNTPVVTSPAVEIAVNRAVPDEVYHQPVATDSFT
HQPAAQNGARFYSPLVLNIATSEGVPFSELENIPGSGTDGRVTKKDILQYVANKKAGKPG
ISTAHTVTATPVHKQEDTTPTILPQVRQVEPQPQQHIQSYSGNVEIVELDRMRKMISEHM
IRSQDTSAHVTSFTECDVTNLVHWRDKVKKQFEKQEGEKLTFTPLFIEAIIRCIKKYPWL
NSSVDGDKLIVKKDINIGMAAALPTGNLIVPVIRNADQLNLVGLTRQVNSLANAARNNKL
KPDDTQGGTFTITNVGTFGSLMGTPIINQPQVAILATGAIKKRPVVIETEQGDFIAIRNM
MYLSLSYDHRVIDGALGSTFLGAVAKELENFSADRTI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggctctagttgacctggtgatgcctaaaatgggtgaaagtattacagaagccactatt
ttaaagtggtttaaaaaccccggtgaaacggtgaagatggatgaggcagtacttgaaatt
gccactgataaggtggacagtgaagtaccttctgtggccgagggtgtaatagaagaaacc
tttttcaaagtaaacgatgtggtgcctgttggtaccgtgctggcccgcatcaggtcaaat
gctgcagaacctgccacaacaaatacgccggtggttaccagtccggcggttgaaatagcc
gtgaaccgcgctgtaccggatgaggtgtatcaccaaccggtagccactgactcgtttaca
caccagcctgctgcccagaacggcgcccgtttttactcgcccctggtgctgaacattgct
accagcgaaggcgttcccttcagcgaactggaaaatattcccggttcaggaaccgatggg
cgtgttaccaaaaaagacattctgcagtatgtagccaataagaaagccggcaaaccaggc
atttccaccgcacataccgttactgccacgcctgttcacaaacaggaagacaccacgcct
actatacttcctcaggttagacaggttgaaccacagcctcagcaacatattcaatcgtac
agcggtaatgttgagatcgttgaactggaccgcatgcgtaaaatgatctctgagcacatg
atccgcagccaggataccagcgcacacgtaaccagctttactgagtgcgatgtaaccaac
ctggtgcactggcgcgataaggttaaaaaacagtttgaaaaacaggaaggcgaaaaactc
acctttacgccgttgttcattgaagccattattcgctgtattaaaaaatatccatggctc
aacagcagtgtggatggtgataaactgatcgtaaagaaagatatcaatataggcatggcc
gccgccctgcccaccggtaacctgatcgttccggttatccgcaacgccgaccagctgaac
ctggttggattgacccgccaggtgaattcactggcgaatgcggcccgcaacaacaaatta
aaacccgatgatacccagggtggcacctttacgataaccaatgtaggtacgtttggcagc
ttaatgggtacgcccatcatcaaccaaccccaggtagctattctggcaaccggtgctatc
aaaaaaagaccggtggtaattgaaaccgaacagggtgactttattgccatccgcaacatg
atgtacctgtcgctgtcgtacgatcaccgcgtaatcgatggtgccctgggttctaccttc
ctgggtgcagtagccaaggagctggagaacttttctgcggacagaacaatataa

DBGET integrated database retrieval system