KEGG   Niastella koreensis: Niako_4493Help
Entry
Niako_4493        CDS       T01679                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nko  Niastella koreensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_4493
  Amino acid metabolism
   00340 Histidine metabolism
    Niako_4493
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Niako_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5609659..5610930
Genome map
AA seq 423 aa AA seqDB search
MQVYQYPERNNWKALLQRPVMNNTALEGSVKNILQEVKQQGDAAVKKFTRQFDKAAISNM
VVSEDEFNTAQEQLDAKLKAAILSAKVNIETFHKTQLTAPEVIETMPGVQCWRKSVGIEK
VGLYIPGGTAPLFSTILMLGVPAKLAGCKEIILCSPPDANGQLNPAILFAAKAVGITKVF
KVGGVQAIGAMAYGTETIPAVSKIFGPGNQYVTCAKQLVQQDGLAIDMPAGPSEVAVYAD
ESAHAAFVAADLLSQAEHGSDSQVVLVSCSQAVINSIEQEINKQVEALPRKDIAGKALAN
SKLILVNNEAEAIDLLNEYAPEHLIICCNNPMPIAEQIINAGSVFLGHYSPESVGDYASG
TNHTLPTNGYAKAYSGVSVDSFVKKITFQQLTQEGLQNISKTVIAMAEAEGLQAHANAVK
VRL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttatcaatatcccgaacggaataactggaaggcattgttacaacggccggta
atgaacaacaccgcgctggaaggctcggtaaaaaacattctgcaggaagtaaaacaacag
ggcgatgctgcggtaaagaaattcacccggcagtttgataaagctgccatcagcaatatg
gtagtaagtgaggatgagttcaacactgcgcaggaacagctcgacgccaaactgaaagca
gcgatcctttcggccaaagtaaatattgaaacctttcataaaacacagcttaccgcaccg
gaggttattgaaaccatgcccggcgtgcaatgctggcgcaaaagcgttggtattgaaaaa
gtgggtctgtatatccctggtggtaccgcgcccctgttctctaccatcctgatgctgggc
gttccggcaaagctggctggttgcaaagagatcatcctgtgttcccctcccgatgccaat
gggcaactgaacccggccattttatttgcagccaaagctgtaggtattaccaaagtattt
aaggtggggggcgtacaggccattggcgctatggcgtatggtaccgaaaccattccagcc
gtatcaaagatctttggtcccggtaatcaatatgtaacctgcgccaaacaactggtgcaa
caggatggactggctatcgatatgccggccggccccagtgaagtagcggtgtatgccgat
gaatcggcccatgcagcctttgtggccgccgacctgttaagccaggcagaacatggcagt
gatagccaggtggtactggtaagttgttcccaggcggtgataaacagcattgaacaggag
atcaacaaacaggtagaagcattaccccgtaaagacattgccgggaaagcactggccaac
agcaaactcatcctggtgaacaatgaagccgaagccatcgatctgttgaatgaatatgca
cctgaacatttaatcatctgttgcaataacccaatgcccatagccgaacagatcatcaat
gccggctctgtgttcctgggtcattattcacccgaaagcgtgggcgattatgccagcggc
accaatcataccctgccaaccaatggttatgccaaagcatacagcggggtaagtgttgac
agctttgtaaaaaagatcacctttcaacaacttacgcaggaaggtttacaaaacatcagc
aaaacagtgattgctatggccgaagcagagggattacaagcacacgccaatgcagttaaa
gttcgattataa

DBGET integrated database retrieval system