KEGG   Niastella koreensis: Niako_4493Help
Entry
Niako_4493        CDS       T01679                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nko  Niastella koreensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nko01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nko00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5609659..5610930
Genome map
AA seq 423 aa AA seqDB search
MQVYQYPERNNWKALLQRPVMNNTALEGSVKNILQEVKQQGDAAVKKFTRQFDKAAISNM
VVSEDEFNTAQEQLDAKLKAAILSAKVNIETFHKTQLTAPEVIETMPGVQCWRKSVGIEK
VGLYIPGGTAPLFSTILMLGVPAKLAGCKEIILCSPPDANGQLNPAILFAAKAVGITKVF
KVGGVQAIGAMAYGTETIPAVSKIFGPGNQYVTCAKQLVQQDGLAIDMPAGPSEVAVYAD
ESAHAAFVAADLLSQAEHGSDSQVVLVSCSQAVINSIEQEINKQVEALPRKDIAGKALAN
SKLILVNNEAEAIDLLNEYAPEHLIICCNNPMPIAEQIINAGSVFLGHYSPESVGDYASG
TNHTLPTNGYAKAYSGVSVDSFVKKITFQQLTQEGLQNISKTVIAMAEAEGLQAHANAVK
VRL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttatcaatatcccgaacggaataactggaaggcattgttacaacggccggta
atgaacaacaccgcgctggaaggctcggtaaaaaacattctgcaggaagtaaaacaacag
ggcgatgctgcggtaaagaaattcacccggcagtttgataaagctgccatcagcaatatg
gtagtaagtgaggatgagttcaacactgcgcaggaacagctcgacgccaaactgaaagca
gcgatcctttcggccaaagtaaatattgaaacctttcataaaacacagcttaccgcaccg
gaggttattgaaaccatgcccggcgtgcaatgctggcgcaaaagcgttggtattgaaaaa
gtgggtctgtatatccctggtggtaccgcgcccctgttctctaccatcctgatgctgggc
gttccggcaaagctggctggttgcaaagagatcatcctgtgttcccctcccgatgccaat
gggcaactgaacccggccattttatttgcagccaaagctgtaggtattaccaaagtattt
aaggtggggggcgtacaggccattggcgctatggcgtatggtaccgaaaccattccagcc
gtatcaaagatctttggtcccggtaatcaatatgtaacctgcgccaaacaactggtgcaa
caggatggactggctatcgatatgccggccggccccagtgaagtagcggtgtatgccgat
gaatcggcccatgcagcctttgtggccgccgacctgttaagccaggcagaacatggcagt
gatagccaggtggtactggtaagttgttcccaggcggtgataaacagcattgaacaggag
atcaacaaacaggtagaagcattaccccgtaaagacattgccgggaaagcactggccaac
agcaaactcatcctggtgaacaatgaagccgaagccatcgatctgttgaatgaatatgca
cctgaacatttaatcatctgttgcaataacccaatgcccatagccgaacagatcatcaat
gccggctctgtgttcctgggtcattattcacccgaaagcgtgggcgattatgccagcggc
accaatcataccctgccaaccaatggttatgccaaagcatacagcggggtaagtgttgac
agctttgtaaaaaagatcacctttcaacaacttacgcaggaaggtttacaaaacatcagc
aaaacagtgattgctatggccgaagcagagggattacaagcacacgccaatgcagttaaa
gttcgattataa

DBGET integrated database retrieval system