KEGG   Niastella koreensis: Niako_5042Help
Entry
Niako_5042        CDS       T01679                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nko  Niastella koreensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_5042
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Niako_5042
  Amino acid metabolism
   00310 Lysine degradation
    Niako_5042
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Niako_5042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6241294..6242535
Genome map
AA seq 413 aa AA seqDB search
MIDIKVPTVGESISEVTLLKWVKNSGDYVERDEVIAELESEKATFEVNAEQAGTLQQSAK
EGDTLKIGDILATIDEKAAKPEKAAATNGTPAKEAKPEAKTAPAVQQPSQAPVTAVSNDI
KATPVAAAMIADKKVDPKSVTPSGYSGKIVKNDVLQALSNPGKVTGGKPLFSREERREKM
SQLRKTISRRLVESKNTTAMLTTFNEVDMSRIMEIRSKFKDKFKEIHGVNLGFMSFFAKA
CAIALQEWPAVGAYIDGDQLVYHDYVDISVAVSTPRGLTVPVIRNVESLSMADIEKKVVE
LAGKARDNKLTMEELTGGTFTITNGGVFGSLMSTPIINLPQSAILGMHKIQERPMAINGQ
VVIKPMMYLAVSYDHRIIDGRESVSFLVRVKELLENPELLLFGKDPVKTLLEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatagatataaaagttccgacagttggagaatccattagcgaggttactttattaaaa
tgggtaaagaacagcggagattatgttgaacgtgatgaagtgatagctgagctggaaagc
gaaaaagccacttttgaagtaaatgccgagcaggcaggcaccctgcaacaatcagccaaa
gaaggtgacacccttaaaattggcgatatcctggctactatcgatgaaaaagcagccaaa
ccggaaaaagcagcggccaccaacggaacaccggcaaaagaagcaaagccggaagcaaaa
acagcacctgcagtacaacaaccttctcaggcgcctgttacagcagtatcaaacgacatt
aaagctacacctgttgcagctgcgatgatcgccgataaaaaagtagatcccaaatctgtt
actcccagcgggtacagcggcaagatcgtgaagaacgatgtattgcaagccttatcaaac
cccggcaaggtaactggcggcaaaccgctgttcagccgtgaggaaagaagggaaaaaatg
agccagctgcgcaaaaccatcagccgccgcctggtagaatcaaagaatacaaccgcgatg
ctcaccacctttaacgaggttgatatgagccgcatcatggaaatacgcagcaagttcaaa
gacaagttcaaggaaatacacggggttaaccttggcttcatgagcttctttgccaaagcc
tgcgccattgctttacaggagtggcctgcagtaggcgcctacatcgatggcgaccaactg
gtatatcatgattatgtagatatctctgttgctgtttctactccccgtggtttaaccgtt
ccggttatccgcaacgtagaaagcctcagcatggccgacattgaaaagaaagtggtagaa
ctggctggtaaagcaagagacaacaaattaaccatggaagaactcactggcggaaccttt
accatcaccaatggtggcgtatttggttcgttaatgagtacacctatcatcaacctgcct
cagagcgccatcctgggtatgcacaaaattcaggagcgccccatggctatcaacggacag
gtagtaattaaaccaatgatgtacctggcagttagctacgatcaccgcatcatcgatggc
cgtgaatctgtaagcttcctggtacgtgttaaagaattactggagaaccctgagctgttg
ttgtttggaaaagatccggttaagactttattggagctgtag

DBGET integrated database retrieval system