KEGG   Niastella koreensis: Niako_5042Help
Entry
Niako_5042        CDS       T01679                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nko  Niastella koreensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_5042
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Niako_5042
  Amino acid metabolism
   00310 Lysine degradation
    Niako_5042
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Niako_5042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6241294..6242535
Genome map
AA seq 413 aa AA seqDB search
MIDIKVPTVGESISEVTLLKWVKNSGDYVERDEVIAELESEKATFEVNAEQAGTLQQSAK
EGDTLKIGDILATIDEKAAKPEKAAATNGTPAKEAKPEAKTAPAVQQPSQAPVTAVSNDI
KATPVAAAMIADKKVDPKSVTPSGYSGKIVKNDVLQALSNPGKVTGGKPLFSREERREKM
SQLRKTISRRLVESKNTTAMLTTFNEVDMSRIMEIRSKFKDKFKEIHGVNLGFMSFFAKA
CAIALQEWPAVGAYIDGDQLVYHDYVDISVAVSTPRGLTVPVIRNVESLSMADIEKKVVE
LAGKARDNKLTMEELTGGTFTITNGGVFGSLMSTPIINLPQSAILGMHKIQERPMAINGQ
VVIKPMMYLAVSYDHRIIDGRESVSFLVRVKELLENPELLLFGKDPVKTLLEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatagatataaaagttccgacagttggagaatccattagcgaggttactttattaaaa
tgggtaaagaacagcggagattatgttgaacgtgatgaagtgatagctgagctggaaagc
gaaaaagccacttttgaagtaaatgccgagcaggcaggcaccctgcaacaatcagccaaa
gaaggtgacacccttaaaattggcgatatcctggctactatcgatgaaaaagcagccaaa
ccggaaaaagcagcggccaccaacggaacaccggcaaaagaagcaaagccggaagcaaaa
acagcacctgcagtacaacaaccttctcaggcgcctgttacagcagtatcaaacgacatt
aaagctacacctgttgcagctgcgatgatcgccgataaaaaagtagatcccaaatctgtt
actcccagcgggtacagcggcaagatcgtgaagaacgatgtattgcaagccttatcaaac
cccggcaaggtaactggcggcaaaccgctgttcagccgtgaggaaagaagggaaaaaatg
agccagctgcgcaaaaccatcagccgccgcctggtagaatcaaagaatacaaccgcgatg
ctcaccacctttaacgaggttgatatgagccgcatcatggaaatacgcagcaagttcaaa
gacaagttcaaggaaatacacggggttaaccttggcttcatgagcttctttgccaaagcc
tgcgccattgctttacaggagtggcctgcagtaggcgcctacatcgatggcgaccaactg
gtatatcatgattatgtagatatctctgttgctgtttctactccccgtggtttaaccgtt
ccggttatccgcaacgtagaaagcctcagcatggccgacattgaaaagaaagtggtagaa
ctggctggtaaagcaagagacaacaaattaaccatggaagaactcactggcggaaccttt
accatcaccaatggtggcgtatttggttcgttaatgagtacacctatcatcaacctgcct
cagagcgccatcctgggtatgcacaaaattcaggagcgccccatggctatcaacggacag
gtagtaattaaaccaatgatgtacctggcagttagctacgatcaccgcatcatcgatggc
cgtgaatctgtaagcttcctggtacgtgttaaagaattactggagaaccctgagctgttg
ttgtttggaaaagatccggttaagactttattggagctgtag

DBGET integrated database retrieval system