KEGG   Niastella koreensis: Niako_5081Help
Entry
Niako_5081        CDS       T01679                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
nko  Niastella koreensis
Pathway
nko00790  Folate biosynthesis
nko01100  Metabolic pathways
Module
nko_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Niako_5081
Enzymes [BR:nko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Niako_5081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEW01320
UniProt: G8T9X6
Position
6300719..6301315
Genome map
AA seq 198 aa AA seqDB search
MGFKKIEQYDEKIMPGLIHHYSESLKLLGEDPQREGLEKTPERVAKAMQYMMQGYDQDAR
AILNSAKFKEPVSEMILVKDIELYSMCEHHMLPFFGKAHIAYIPNGYITGLSKLARVVDV
YARRLQVQERLTTQILDAIKETLNPLGVAVVIEAKHLCMMMRGVQKQNSVTTTSAFWGEF
EKNETRSEFTKLISSRLH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaaaaaaatagaacaatacgacgagaaaataatgccggggcttattcaccac
tactccgaatcactgaaactgctgggcgaggatccgcaacgggaagggttggagaaaaca
ccggaacgcgttgccaaagccatgcagtacatgatgcagggttacgatcaggatgccagg
gctattttaaattcagccaagtttaaagaacctgtcagtgaaatgatcctggtaaaagat
attgagttgtacagtatgtgcgagcatcatatgctgcccttcttcggcaaagcacatatt
gcctatattcctaatggatatattaccggtcttagcaaactggcccgggtggttgatgta
tacgcccgccgtttacaggtacaggaacgccttaccacccaaatactggatgccattaaa
gaaactttgaatccactgggcgtggccgtggttattgaagccaaacacctttgtatgatg
atgcgcggggtgcaaaaacaaaattcagttaccacaacatcggctttctggggtgagttt
gagaagaacgagacccgtagcgagtttaccaagttaatatccagcagattgcattga

DBGET integrated database retrieval system