KEGG   Niastella koreensis: Niako_5081Help
Entry
Niako_5081        CDS       T01679                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nko  Niastella koreensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Niako_5081
Enzymes [BR:nko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Niako_5081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6300719..6301315
Genome map
AA seq 198 aa AA seqDB search
MGFKKIEQYDEKIMPGLIHHYSESLKLLGEDPQREGLEKTPERVAKAMQYMMQGYDQDAR
AILNSAKFKEPVSEMILVKDIELYSMCEHHMLPFFGKAHIAYIPNGYITGLSKLARVVDV
YARRLQVQERLTTQILDAIKETLNPLGVAVVIEAKHLCMMMRGVQKQNSVTTTSAFWGEF
EKNETRSEFTKLISSRLH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaaaaaaatagaacaatacgacgagaaaataatgccggggcttattcaccac
tactccgaatcactgaaactgctgggcgaggatccgcaacgggaagggttggagaaaaca
ccggaacgcgttgccaaagccatgcagtacatgatgcagggttacgatcaggatgccagg
gctattttaaattcagccaagtttaaagaacctgtcagtgaaatgatcctggtaaaagat
attgagttgtacagtatgtgcgagcatcatatgctgcccttcttcggcaaagcacatatt
gcctatattcctaatggatatattaccggtcttagcaaactggcccgggtggttgatgta
tacgcccgccgtttacaggtacaggaacgccttaccacccaaatactggatgccattaaa
gaaactttgaatccactgggcgtggccgtggttattgaagccaaacacctttgtatgatg
atgcgcggggtgcaaaaacaaaattcagttaccacaacatcggctttctggggtgagttt
gagaagaacgagacccgtagcgagtttaccaagttaatatccagcagattgcattga

DBGET integrated database retrieval system