KEGG   Niastella koreensis: Niako_5087Help
Entry
Niako_5087        CDS       T01679                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nko  Niastella koreensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nko03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6307760..6308344
Genome map
AA seq 194 aa AA seqDB search
MIAFVRGQFVLKTPAVVHIEANGVGYELHISLNTYSHIQSLDKGLLYTHLHIKEDAHTLY
GFFDVAEKELFQQLLSVSGVGAATARMMLSSLKPEELSAAIVQGNTRLLESIKGIGKKSA
ERIVLELKDKLSKSKPGLNISPLINNTLEQDALNALIALGIARSSAEQAVQRVVKAEPSL
SAVEEIIKKALKTI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcatttgtaagaggacagtttgttctaaaaacaccagccgttgtacacatcgaa
gccaacggcgtgggctacgagcttcatataagtctgaatacctattcacatatccagtcg
ctcgacaaaggactgttgtatacgcacttgcacattaaggaagatgcgcataccctctat
ggcttcttcgatgtggcagaaaaagagttattccagcagctcttaagcgtatcgggcgtg
ggagcagctaccgcccgcatgatgctgtcttccctgaaacctgaagaactgtcggcggct
attgtgcagggaaataccagattactggagtcaattaagggtatcgggaagaagtcggcc
gaacgtatcgtattggaactgaaggataaactcagcaaatccaaaccgggtctaaatatt
tcacctttgattaacaatacgctggaacaggacgcgttaaatgccctgattgcactgggg
attgcccgatcttcggccgaacaggcagtacaacgcgttgtaaaagcggaaccttctctc
agtgctgttgaggaaataattaagaaagctctaaaaaccatataa

DBGET integrated database retrieval system