KEGG   Niastella koreensis: Niako_5087Help
Entry
Niako_5087        CDS       T01679                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nko  Niastella koreensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nko00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Niako_5087
Enzymes [BR:nko01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Niako_5087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6307760..6308344
Genome map
AA seq 194 aa AA seqDB search
MIAFVRGQFVLKTPAVVHIEANGVGYELHISLNTYSHIQSLDKGLLYTHLHIKEDAHTLY
GFFDVAEKELFQQLLSVSGVGAATARMMLSSLKPEELSAAIVQGNTRLLESIKGIGKKSA
ERIVLELKDKLSKSKPGLNISPLINNTLEQDALNALIALGIARSSAEQAVQRVVKAEPSL
SAVEEIIKKALKTI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcatttgtaagaggacagtttgttctaaaaacaccagccgttgtacacatcgaa
gccaacggcgtgggctacgagcttcatataagtctgaatacctattcacatatccagtcg
ctcgacaaaggactgttgtatacgcacttgcacattaaggaagatgcgcataccctctat
ggcttcttcgatgtggcagaaaaagagttattccagcagctcttaagcgtatcgggcgtg
ggagcagctaccgcccgcatgatgctgtcttccctgaaacctgaagaactgtcggcggct
attgtgcagggaaataccagattactggagtcaattaagggtatcgggaagaagtcggcc
gaacgtatcgtattggaactgaaggataaactcagcaaatccaaaccgggtctaaatatt
tcacctttgattaacaatacgctggaacaggacgcgttaaatgccctgattgcactgggg
attgcccgatcttcggccgaacaggcagtacaacgcgttgtaaaagcggaaccttctctc
agtgctgttgaggaaataattaagaaagctctaaaaaccatataa

DBGET integrated database retrieval system