KEGG   Niastella koreensis: Niako_5286Help
Entry
Niako_5286        CDS       T01679                                 

Definition
nitrous oxide reductase apoprotein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
nko  Niastella koreensis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Niako_5286
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Niako_5286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6571891..6573867)
Genome map
AA seq 658 aa AA seqDB search
MHMKPLNQTLLLISLAAGSWLTACKPNNAATAISGDAAVKAYVPPGKYDEFYNFVSGGFS
GQLSVYGLPSGRLLRVIPVFSVDPEKGYGYSENTKAMLNTSHGFVPWDDLHHTELSQTNG
EIDGRWVFANANNTPRVARIDLKTFRTAEILELPNSAGNHSSPFITENTEYVVAGTRFSV
PTGDNQDVPIASYKQNFKGSLSFISVEPTTGKMDIAFQLQTPGVNFDLSHAGKGPSHGWF
FFSCYNSEQANTLLEVNASQRDKDFILAVNWKKAEEYLKAGKGVKKASKYSRSHYDEKTH
QATNEIMNEVTVLDPAVLKDICYFIPCPKSPHGCDVDPTGEYIVGSGKLAALLPVFSYTK
IQKAIADKAFDGEFEGIPVIKYEAALYGEVQKPGLGPLHTEFDGKGNAYTSFFVSSEIVK
WNIKDLKVLDRVPTYYSIGHLCVPGGDSRKPNPKYVIAYNKITKDRYLPTGPELAQSAQL
FDISGDKMQLILDFPTIGEPHYAQAVSADLISKNSTRIYKIDENANPYVSKGEKETKVVR
EGNKVHVYATAIRSHFSPDNIEGVKLGDEVYFHVTNLEQDWDIPHGFAVKGANNAELLIM
PGETQTLKWVPEKAGVYPFYCTDFCSALHQEMSGYIRVSAPGNNVPISFSLGKTNETK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgaaacctcttaatcaaacgcttcttttaatatcgttggccgctggttcctgg
ctaaccgcttgcaaaccgaataatgctgctactgctataagcggtgatgcggctgttaaa
gcctacgtaccccccggcaaatacgatgagttttacaattttgtttccggtgggtttagt
gggcaactatccgtttatggattgccttcgggccgcctgctgcgcgttatccccgttttt
tccgttgaccctgaaaaaggatatggttacagcgagaataccaaagccatgctgaatact
tctcatggttttgttccctgggacgatctgcaccataccgaactatcccaaacaaatgga
gaaattgatggtcgatgggtgtttgccaatgccaataataccccccgtgtagcccgcatc
gatctcaaaactttccgtaccgccgagattcttgaattacccaacagcgccggtaaccac
tcttctccttttataaccgagaatacagagtatgtggtagctggtacccggttcagcgta
cctactggcgataatcaggatgtacctattgcttcctacaaacaaaacttcaaaggctcc
ctgagctttatcagtgtggaaccaactaccggtaaaatggacatcgccttccagctgcag
acaccgggggtgaacttcgacctgagccatgccggtaaaggccccagccatggctggttc
ttctttagctgttataattcagaacaggccaatacgctgttggaagtaaacgcttcccaa
cgcgataaagactttattctggccgttaactggaaaaaagcagaagagtacctgaaggca
ggcaaaggcgttaagaaagcctctaaatacagccgcagccactatgacgagaaaacacac
caggctacaaatgagatcatgaatgaagtaaccgtgctcgatccggcggtgttgaaagat
atctgttactttattccctgtcctaaatcaccccacggttgcgacgttgacccaaccggt
gaatacattgtaggcagtggtaaactggccgccttattaccggtgttctcttacaccaaa
atacaaaaggcaattgccgacaaagcctttgatggcgagtttgaaggcattcctgttatc
aaatacgaagccgccctgtatggcgaagtgcagaaaccaggccttggcccgttgcacacc
gagtttgatggcaaaggaaatgcgtacacttccttctttgtatcgtcggaaattgtaaaa
tggaatatcaaagacctgaaagtgctcgaccgtgtgcctacttattattccattggtcac
ctgtgcgtacctggtggcgacagccgtaaacccaatccgaaatatgtaattgcctataac
aagatcaccaaagaccgttacctgccaactggtcccgaactggcgcaaagtgcgcagctc
tttgatatcagcggcgataaaatgcagctgatcctcgacttcccgactattggcgagccg
cactatgcacaggctgtttcggccgatctcatctcaaagaattcgaccaggatctacaag
atagatgagaatgccaatccatatgtatccaaaggcgagaaagaaacaaaggtggtacgc
gaaggcaataaagtacatgtgtatgcaaccgccatccgcagccacttttcacctgataat
atcgaaggcgtgaagctgggcgatgaagtgtacttccacgttaccaatcttgaacaggac
tgggacattccgcacggctttgcagtaaaaggcgccaacaacgccgaactgctgattatg
cccggcgaaacccaaaccctgaaatgggtaccggaaaaagcaggcgtttatcctttctat
tgcaccgacttctgtagtgctttgcaccaggaaatgagtggttacatccgtgtatctgca
ccgggcaacaatgtgccaatcagttttagcctgggcaaaaccaatgagactaaataa

DBGET integrated database retrieval system