KEGG   Niastella koreensis: Niako_5379Help
Entry
Niako_5379        CDS       T01679                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nko  Niastella koreensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nko00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nko00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nko00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6708308..6710458
Genome map
AA seq 716 aa AA seqDB search
MKYTLLWLFNLLVITALSQPTSPIVIQTKNTSLVFTIGKNHRVYQSYLGARLANTEYSTL
TGGQEAYLTAGMENLFEPAIRLVHADGNPSLELTYASHTANQQGNVTTTRIILKDSVYPV
EVVLQYTAYFNEDVITASATIQHHEKKPVRLTHYASTMLHFNADNYWLTQFHGEWAREAQ
MVDEQLTNGVKNIESKLGARADFYQTPTFFLSLNNPSTETSGELIAGTLGWTGNFQFTFE
VDQRNQLRVRPGINPYASDYTLKPGELFTTPDFIFTYSNQGKGQASRNLHRWARNYGVLD
GNGPRLTLLNNWEATYFNFNEDKLVELFDGAKQLGVDMFLLDDGWFGNAFPRNDDKAGLG
DWQENKTKLPHGIGHLVSEADKKGIKFGIWLEPEMVNPKSELYQKHPDWILRLPNRAENL
SRNQLVLDLTNPAVQNFVFGIVDSMLTKNPGVAYIKWDCNRPMSNTYSPYLKENQSHLFI
EYTRSFYKVLDRIRAKYPHLPIMLCSGGGGRTDYGALKYFTEFWPSDNTDGLERVFIQWG
YSYFFPANTIAAHITSMGKGQSLKFRTDVAMSAKLGYDIRVNEMTPQELQFSQEAVKNYK
QLSDVIWYGDLYRLISPYEENRSVLLYVNDQKSKAVLFNYNLTTRRKDLFTKVQLQGLDP
KKNYRFRETNLFPGTKATNPDNDKVFTGEYLMTIGLNLTPGKVVPLTSNIFEITAE
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatactttgttgtggttattcaatctgcttgtaattacagccctttcccaaccc
acctcacctatcgttattcaaacaaaaaataccagcctggtttttaccattggcaaaaat
caccgggtgtatcaaagctacctgggagcacgattagccaatacggagtattcgacatta
acgggcggacaggaagcatacctgaccgccgggatggaaaacctgtttgaacctgccatc
cgtctggtgcatgccgatggcaatccctcgcttgaattaacctatgcttcgcatactgcc
aaccaacagggtaatgtaaccactacccgtattatattaaaagattcggtttacccggtg
gaagtggtgttgcaatacacagcttattttaatgaagatgttattaccgccagtgccacc
attcaacaccatgaaaaaaaaccggtgcggcttacacattacgcctccaccatgttgcac
tttaatgccgacaattactggttaacccagtttcatggcgaatgggcccgtgaagcgcaa
atggttgatgaacaattgaccaatggagtaaagaatatcgaaagcaaactgggtgcgcgt
gccgacttttatcaaacgcccactttctttctatcgctgaataatccctccaccgaaacc
agcggcgagctgattgccggtacgctgggctggacgggcaattttcaattcacctttgaa
gtagatcaacggaatcagttgcgggtgcggccgggtattaatccctatgcatctgattac
acgttgaaacccggtgaactgttcacgacgcccgattttattttcacctatagcaaccag
ggtaagggccaggccagtcgaaacctgcatcgctgggcgcgcaactatggcgtgctggat
ggcaatggcccacgtcttactttattaaataactgggaagccacttattttaacttcaat
gaagataaactggttgaactgttcgatggcgccaaacaactgggcgttgatatgttcctg
ttggatgatggttggtttggcaatgcatttccccgtaacgatgacaaagccggcctgggc
gactggcaggaaaataaaaccaaactgccgcatggcattggccacctggtgagcgaagca
gataagaagggaattaaattcgggatctggctggaacccgaaatggtaaatcctaaaagt
gaactgtatcaaaaacatcccgactggatcttaagactgcccaaccgcgcagagaacctg
tcgcgcaatcaactggtgctcgatttaaccaaccctgccgtacagaattttgttttcggg
attgtagacagcatgcttacgaaaaacccgggtgttgcatatatcaagtgggattgcaac
cggcctatgtcaaacacctactcaccctacctgaaagaaaaccagtcacatttatttatt
gaatacacccgcagcttttataaagtgcttgaccgcatccgcgccaaatatccgcacctg
cccattatgctttgttccggtggtggcggccgaaccgattacggcgcgctcaaatatttc
acggagttctggccaagcgacaataccgacggtttagaacgtgtgtttattcaatggggc
tactcttatttctttccggccaataccattgcggcgcatataaccagcatggggaaagga
caatcacttaaattccggactgatgtggccatgtcggccaaacttggttacgatattcgc
gtgaatgaaatgacaccgcaggaactacagtttagccaggaggcggtaaaaaactataag
caacttagtgatgtaatctggtatggcgatttgtaccgccttatttcaccttatgaagaa
aaccgctccgttctcctatatgtgaacgatcaaaaaagtaaagccgttttgttcaattat
aacttaaccacccgccgcaaagaccttttcaccaaagtgcaattgcagggcctcgatcct
aaaaagaactaccggttccgcgaaaccaacctgtttcccggcaccaaggccaccaatcct
gataatgataaagtgttcaccggcgaatacctgatgacgattgggttgaaccttacacca
ggtaaagtagtgccattaacaagtaatatatttgaaataaccgctgaatag

DBGET integrated database retrieval system