KEGG   Niastella koreensis: Niako_5523Help
Entry
Niako_5523        CDS       T01679                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_5523
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_5523
   00020 Citrate cycle (TCA cycle)
    Niako_5523
   00620 Pyruvate metabolism
    Niako_5523
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Niako_5523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6889316..6890977
Genome map
AA seq 553 aa AA seqDB search
MAEVILMPRLSDTMTEGVIAAWHKKVGDKVKKGDLLAEVETDKATMELESYKDGTLLHIG
TEKGGKLQVNDLLAIIGNPGEDISSLLGGGGQKAAAAPSAPAPEAPKAEQAAAAQPAAAG
GATLDLANMQEVILMPRLSDTMTEGVIAAWHKKVGDNVKKGDLLADVETDKATMELESYK
EGKLLYIGAQKGDKVPVNALLCIIGDEKKVNVDQIVAAAKGGGSSTSAAAAQSQPQAASQ
PAVTASATAETAAPAASGSNGRVLASPLAKKLAADKGIDISKVAGSGDGGRIIKRDIDNY
TPAAGGGQAAQTTAQPGKTTAPAVAGQVSFEDVPVSQMRKVIAKRLSESKFTAPEFYLTM
EINMDKAVESRAKINEIAPVKISFNDMVLKACAIALKQHPKVNSSWMGDKIRVNHHVNIG
VAVAVEEGLLVPVVRFADLKSLSQIGTEVKEFAKKAKDKKLQPSDWEGSTFTISNLGMFG
IEEFTAIINPPDACILAVGAINQVPIVKNGQIVVGNTMKVTLTCDHRVVDGATGAAFLQT
LQQLLEEPLRMLV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgatcttaatgccccgcctgagcgataccatgacagaaggcgtgatagcg
gcctggcataaaaaggtaggcgacaaagtaaagaaaggcgacttactggctgaggtggaa
accgataaagccaccatggaactggaaagttataaagatggcaccctgcttcacattggt
actgaaaaagggggaaaactacaggtaaatgatctgctggccattattggtaacccaggt
gaagatatcagctcgttgcttggtggtggtggtcaaaaagccgctgctgctccatctgcc
ccggcgcctgaagcaccaaaagccgaacaagctgccgccgctcaaccagccgctgccggt
ggcgctacgctcgacctggccaatatgcaggaagtgatcctgatgcctcgcttaagcgat
accatgacagaaggcgttattgccgcctggcataaaaaagtgggcgacaacgttaaaaaa
ggcgacctgctggctgacgtggaaaccgacaaggctaccatggagctggaaagctataaa
gaaggaaaattattatatatcggtgcgcaaaaaggcgataaagttcctgttaacgccctg
ctgtgcatcattggcgacgaaaagaaagtaaatgttgaccagatcgtagctgccgccaaa
ggtggtggttcatctacttctgccgccgctgctcaaagccagccacaagctgcttcccag
cctgctgtaaccgccagcgcaacagccgaaactgccgctcctgccgcatccggcagcaat
ggcagagtgctcgcttcacccctcgctaaaaaattagccgccgataaaggcatcgatatt
tccaaagttgccggttccggcgatggcggccgtatcattaaacgcgatattgacaattat
acgcctgctgcaggtggtggacaagccgctcaaacaactgcacagcctggtaaaactacc
gcccctgccgttgccggccaggtaagctttgaagatgtaccggtttcgcaaatgcgtaag
gtaattgccaagcgtctttctgaaagcaagttcactgcacctgagttctacctcaccatg
gaaatcaacatggataaagccgtagaaagcagagccaaaataaatgaaatagccccggtt
aagatttcgttcaacgacatggtgttaaaagcctgcgctattgccctgaaacaacaccct
aaagtgaacagcagctggatgggcgataagatccgcgttaaccatcatgtgaacatcggt
gtagccgttgctgttgaagaaggcttactggtgcctgttgtacgttttgccgatctgaaa
tcattatcacagattggaactgaagtaaaagagtttgcgaaaaaagcaaaagataaaaaa
ctgcaaccatctgattgggaaggcagcaccttcaccatcagcaacctgggtatgttcggc
attgaagaattcactgccatcattaacccaccagacgcttgtatcctcgctgtaggcgcc
attaaccaggttcctatagtgaagaatggtcagatcgttgttggtaacaccatgaaagtt
accttaacctgcgaccaccgcgtggttgacggagctaccggcgccgccttcctccaaacg
ctgcaacagttgttggaagagccgttgagaatgctcgtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system