KEGG   Niastella koreensis: Niako_5724Help
Entry
Niako_5724        CDS       T01679                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nko  Niastella koreensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Niako_5724
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Niako_5724
Exosome [BR:nko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Niako_5724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7133343..7134317
Genome map
AA seq 324 aa AA seqDB search
MYLQRRNRILRQSPAIRSMVAETILTPNDFIVPLFINEGEHYKEEIASMPGYYRMSLDNT
IKEVKELWSMGIKSVLLFVKSKDELKDNKGTEALNPKGLMQRSIRAVKDACPEMLVMTDV
ALDPFSSFGHDGIVEGAEIVNDATVEVLAQMSVSHAQAGADFVAPSDMMDGRIAAIREAL
EEHGLNKTGIMSYSAKYASCFYGPFRDALDSAPGFGDKKTYQMDYSNRIEAVKETLMDVE
EGADIVMVKPALAYLDIIREVKNAVSVPVSAYNISGEYAMIKAAAKMGWIDENKAILETL
TAIKRAGADLIATYFAKDAVRLIS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatttacaacgtcgaaaccgcatactacgtcagtcgcctgcgatcagaagcatggtg
gctgagactattttaacaccgaatgattttattgtacccctgttcatcaatgagggcgag
cattataaagaagagatcgcttccatgcctggctattaccgcatgagcctcgacaacacc
ataaaggaagtaaaggaactgtggagcatgggtataaaaagcgtgttgctgtttgttaaa
agtaaagacgaactgaaagacaataaaggtaccgaagctttaaacccaaaaggtttgatg
caacgaagtataagagcggtaaaagatgcctgtcccgaaatgctggtgatgaccgatgtg
gccctcgatccattctcttcatttggccacgacggtattgtagaaggtgctgaaattgta
aacgatgctactgttgaagtgctggcgcaaatgagcgtaagtcatgcccaggcgggtgct
gattttgtagcacccagcgatatgatggatggccgcattgccgccattcgcgaagcactg
gaagaacatggattgaataagaccggcatcatgagctatagcgccaagtacgcgtcctgc
ttttatggtcctttccgcgatgcgctggacagcgctcccggttttggcgataaaaaaacc
taccagatggattacagcaatcgcattgaagcggttaaagaaaccctgatggatgtagaa
gaaggcgcagatatcgtaatggtaaaaccagccctggcttacctggatattattcgtgaa
gtgaagaatgcagtatctgtacctgttagcgcttacaatatcagtggtgaatatgccatg
ataaaagcggccgccaaaatgggctggatcgatgagaacaaagccatactggaaacgctt
actgctattaaaagggccggcgctgatcttattgctacgtactttgccaaagacgcggta
agactaattagctaa

DBGET integrated database retrieval system