KEGG   Niastella koreensis: Niako_5800Help
Entry
Niako_5800        CDS       T01679                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nko  Niastella koreensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Niako_5800
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Niako_5800
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Niako_5800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7223050..7223565
Genome map
AA seq 171 aa AA seqDB search
MIRLLLVSLLFIGAQSIYDFKVPALDGAGTIDFKKFKGKKIMIVNTASKCGNTPQYAELE
KLYEQYKDKLVIVGFPANNFGGQEPGTNGEIQEFCKKNYGVSFPMAEKVSVKGDDIHPLF
KYLVAEAEKKGFTDPIKWNFTKFLLDEKGNLITVIHNKTKVTSEEVTKYLN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtttattgcttgtatccctgctttttatcggagctcagtctatttacgatttt
aaggttcctgcattagatggcgcaggcactatcgacttcaaaaaattcaaaggcaaaaag
atcatgatcgtgaacacggcatctaaatgtggcaacaccccacaatatgccgaactggaa
aaattatatgagcagtacaaagacaaactggttattgtaggttttccagccaacaacttt
ggcggtcaggagcctggcaccaatggagagatccaggagttttgcaaaaagaattatggt
gtaagtttccctatggctgaaaaggtttcggtaaagggcgacgacattcaccccttgttc
aaatatctggtggccgaggccgaaaagaaagggtttaccgatcccattaaatggaacttc
accaagttcctgttagatgagaaaggcaacctcatcaccgtgatccacaacaaaacaaaa
gttaccagcgaagaagtaaccaagtatctgaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system