KEGG   Niastella koreensis: Niako_5922Help
Entry
Niako_5922        CDS       T01679                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
nko  Niastella koreensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Niako_5922
   00500 Starch and sucrose metabolism
    Niako_5922
Enzymes [BR:nko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Niako_5922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7364950..7365978
Genome map
AA seq 342 aa AA seqDB search
MKQLAFLLAVACIGFTTVQAQTANPQQYKYVFTVAKDGTGDYKYIQDAIDAMRVYPLAPI
TLYIKNGVYNEKIELPASNTDVTFIGESVDKTIIVFNDYSGRGKLTTFTSYTAKICGNRF
RAENLTFSNSAGPVGQAVALHVEADNAMFVNCRFLGNQDTIFTGGETSRQLFVNCYIEGT
TDFIFGPATVVFQGCEIHSKTNSFVTAASTTQGKKFGYVFLDCKLTADTSVHKVFLGRPW
RANAKTVYLRCIMGNHIVPEGWNNWSNPANEQTTFYAEYKCSGAGAYIANRAKWSHQLTD
KEAANYTLNTIFNNEGAALPVNAKWYQEQGTRAFQWPGKAEK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcttgctttcctgcttgccgtcgcttgtataggctttaccactgtacaggca
caaaccgccaacccgcaacaatacaaatatgtttttaccgtggccaaagacggcaccggc
gattacaaatacatccaggacgccatcgacgccatgcgggtatatcccctggcgcctatt
acgctttatataaagaacggggtgtacaatgaaaaaattgaactgcctgccagcaatacc
gatgtaacctttattggcgaaagcgttgataaaaccattattgttttcaacgattactca
ggccgtggcaagctcaccaccttcacttcctatacggccaagatctgcggcaaccgtttc
agggccgaaaaccttaccttttccaattctgccggtcctgttggccaggcagtagccctg
catgtggaagccgataatgcgatgtttgtaaactgccgctttctcggcaaccaggatacc
atttttaccgggggagaaacatcccgccagctgtttgtaaactgctacatcgagggcacc
accgatttcattttcggcccggccacggttgtttttcagggttgtgagatccacagtaaa
accaattcatttgttaccgccgccagcaccacccagggtaaaaagttcgggtatgtgttc
ctggattgtaaactcacggcagacaccagcgttcataaagtatttctgggccgtccctgg
cgggcaaatgcgaagacggtttatttgcgttgcatcatgggcaaccatatagtgcccgaa
ggctggaacaactggagcaatcctgccaatgagcaaactacgttttatgcggaatacaag
tgcagcggtgccggcgcctacatcgccaaccgcgccaaatggagccaccagcttaccgac
aaagaagcggccaattataccctgaacactattttcaacaatgaaggggccgctttaccg
gtaaatgcaaaatggtaccaggagcagggaacacgggcgtttcaatggccgggaaaggca
gagaaatga

DBGET integrated database retrieval system