KEGG   Niastella koreensis: Niako_6017Help
Entry
Niako_6017        CDS       T01679                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nko  Niastella koreensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nko00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Niako_6017
DNA repair and recombination proteins [BR:nko03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Niako_6017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7469635..7470345
Genome map
AA seq 236 aa AA seqDB search
MVFLCKSARYEDIIFYRTKNRELGTSGYLCSMEFSSSLLESAVSEFAKLPGIGKKTALRL
VLHLLKQDTGNVEVFGDAVLKMRREIKFCERCHNVSDATTCAICANPLRKQELICVVENI
RDVIAIESTQQFNGIYHVLGGIISPLDGIGPDQLTIDPLIQRIAKEKTEELIFALNPNIQ
GDTTIYYIQKKLTGTPVRITTIARGIAFGGELEYADEMTLARSITNRLPVEKYVQH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ttggtattcctttgtaaatctgcgcgttacgaggatataatcttttatcgaaccaagaac
cgggaacttggaacttcgggttatctttgcagtatggaattctcctcgtctttgttggaa
agtgcggtaagtgaatttgccaaattacccggtattggtaaaaaaacagcccttcggctg
gtgctgcatttattaaagcaggacaccggtaatgtggaagtatttggtgacgccgtgctt
aaaatgcgccgggaaataaagttttgcgagcgttgtcacaacgtgtccgacgctacaacc
tgcgccatctgcgccaatccgttgcgcaaacaggagcttatttgtgtggtggagaatatc
cgggatgtaattgctattgaaagcacccagcagttcaatggcatataccatgtgctgggt
ggcattatttcgcccctggatggtattggccccgatcagcttactattgacccccttata
caacgcatagctaaagaaaagacggaggaactcatttttgccctcaacccaaatatccag
ggcgataccactatttattatatccagaagaagttaacaggaacacctgtcagaataaca
actattgcccggggcatagcctttggcggcgagctggaatatgccgatgaaatgaccctt
gcccgcagcattaccaaccgcctgccggttgaaaagtacgttcagcactag

DBGET integrated database retrieval system