KEGG   Niastella koreensis: Niako_6170Help
Entry
Niako_6170        CDS       T01679                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
nko  Niastella koreensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nko00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nko00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7646864..7648324)
Genome map
AA seq 486 aa AA seqDB search
MKSVKRNPPYSMFNPVVLLFCMMLGGDCKKSSVKENPPPTPDPPVASDVLFYLTRGDRDV
LFNKQNVKLVFSAGGSAATTIEVDTTQTFQSIDGFGYTLTGGSASLLNSLPAATLDPLLK
ELFLWDSTNIGISYLRISIGASDLSASTFTYDDMPSGQTDPNLTNFSIDREKQDLIPILK
KIVALNPAIKILGSPWSAPLWMKSTGSFVGGSLKPECYATYANYFVKYIQAMKAEGITID
AITPQNEPLHGGNNPSMVMQATEQATFIKNNLGPAFAAAGINTKIIAYDHNADKPDYPIT
VLSDAGAKPYVNGSAFHLYGGSITALTQVHDAYPDKAVYFTEQWVGGPGNFPTDLKWHVE
NLIIGATRNWSRNVLEWNLAADAGYNPHTPGGCTTCLGALTIGSTVTRNVSYYIIAHASK
FVRPGSIRIGSVDAGNIVTVAFKNPEGKKVLIALNKGTDTEPFNIKFNGKMVTTSLYGGA
VGTFVW
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagtaaaaagaaatcccccatatagtatgttcaaccctgtagtattgttgttt
tgtatgatgctgggcggcgactgtaaaaagagcagtgttaaagaaaatccaccgcctaca
ccagatccgcctgttgcaagtgatgtacttttttacttaacccgtggcgaccgggatgta
ttgttcaataaacagaatgtaaagctggtattttcagctggcggtagtgctgccaccacc
atagaagttgataccacacaaacctttcaatccatcgacggttttgggtacaccttaacc
ggcggcagtgcttccctgctgaattccctgcccgcggctacccttgacccgttattgaag
gagctttttttgtgggacagtaccaacattggaataagttatttacgtataagtattggc
gcttcagacctcagcgcttctacatttacctatgatgatatgccttcagggcaaaccgac
cccaaccttaccaacttcagcattgacagggaaaagcaggacctgatacccatcctgaaa
aagatcgttgcattaaatcctgccatcaagatattagggtcaccctggtcggccccgttg
tggatgaagagcaccggcagctttgtaggcggcagcctgaagccggaatgttatgctact
tacgccaattattttgtgaaatacattcaggccatgaaggccgaaggtatcaccatcgat
gctattactccacagaacgaaccactgcatggcggtaacaatcccagcatggtaatgcag
gccacagagcaggccaccttcatcaaaaataatttagggcccgcttttgccgcagccggt
attaataccaagatcatcgcttacgatcacaatgccgacaagcccgattatccgatcact
gttttaagtgatgccggtgcgaagccctatgtaaatggttctgcctttcacctgtatggc
ggcagcattacagcgcttacccaggtgcatgatgcgtatcccgacaaagccgtttacttt
actgaacaatgggtaggtggccctggaaactttcctaccgatctgaaatggcatgtagag
aacctgatcattggggctacccgtaactggagccgtaatgtgctggagtggaacctggct
gcagatgccggttacaacccgcatacccccggaggatgtactacctgtttgggcgccctt
acaataggttcaaccgttacccgcaatgtgtcctattatattattgcgcatgcatccaag
tttgttcgtcccggttcaatcagaatagggtcagtagatgcaggtaatattgtaaccgta
gcgttcaaaaatccggaaggtaaaaaagtattgatagctttgaacaagggaaccgatacg
gaacctttcaatataaaattcaatggcaaaatggtaactaccagcctgtatggtggcgcc
gtgggaacatttgtatggtaa

DBGET integrated database retrieval system