KEGG   Niastella koreensis: Niako_6440Help
Entry
Niako_6440        CDS       T01679                                 

Definition
maltooligosyl trehalose hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nko  Niastella koreensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Niako_6440
Enzymes [BR:nko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Niako_6440
Exosome [BR:nko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Niako_6440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7948190..7950004
Genome map
AA seq 604 aa AA seqDB search
MSKSTTAAAPEIHIEGMGSIPHENGVFFRVWAPHAKKVFVTGEFNNWSKNKHPMTHEGNG
YWGLNIPDAKAGNQYKYILQTDMGLLHRNDPYARELTNSAGNSIITDPHFEWTDHDFKMP
SWNELVIYEMHIGTFNVKEDGKPGTFETARQRLGYLKALGVNALEIMPATEFPGGISWGY
NLSHPYAIESDYGGVKGFKELINAAHELGIAIILDVVYNHFGPSDLDLWQFDGWSENGAG
GIYFYQDWRAETPWGHTRPDYGRPEVRQYLRDNALMWLEDYHIDGLRTDALLFVRNAQGK
NLPEADLPEGWTLMKWINEEVKKRFPWKITIAEDLQDNEWITKGTEDNGEGFNTQWDPAF
TFSVRDVLKVPEDEHRDLDKIQFAINHNFNGDAFQRVIYTESHDDVANGKTRVPEEITPG
DAQSWFAKKRSVLGAVLVFTAAGIPMIFQGQEFVEGGWFDDTRPLDWSKFSDFKGIARLY
RDCISLRRNMEGLTKGLSGQHTRIIHVNNEDKVIAFHRWYEGGPKDSTIVVLNFMNKEHK
DYVIGVPEEGVWKVRFNSDWKGYDESFTDAAVFDVETFTSSKDEQEFSISLNMGPYNALI
LSRD
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaagtactacagccgcagcaccggaaatccatatagaaggaatgggttccatc
cctcacgagaatggcgtattcttcagagtttgggcgccacatgcaaaaaaggtatttgtt
accggcgagtttaataactggtcaaagaataaacaccctatgacgcatgaaggcaatggg
tattggggcctgaatattcctgacgccaaagcagggaatcaatataaatacattctgcaa
acagatatgggtttgctgcaccgcaacgacccgtatgcaagggaattaaccaactccgcg
ggtaactccattatcaccgatccgcactttgaatggacggaccatgactttaaaatgcca
tcctggaatgagttggtgatctatgaaatgcacattggcacattcaatgtaaaggaagac
gggaagcccggtacttttgaaaccgcccggcaacggctggggtatttaaaagcgctgggt
gtgaacgcccttgaaatcatgcctgccaccgaatttccgggtggtatttcctgggggtat
aatttgtctcacccgtatgctattgaatcagattatggcggtgtaaagggttttaaagaa
ctcatcaatgctgcccatgaattggggattgccattattctggatgtggtgtataaccat
tttgggccttcagaccttgacctgtggcaatttgatggctggagcgagaatggagcaggt
gggatctacttctaccaggactggcgggctgaaacgccctggggccatacccggcccgat
tatgggcgccccgaagtcaggcagtacctgcgcgacaatgccctgatgtggctggaagat
tatcatatagacggcctgcgtaccgatgcgctgctttttgtgcggaatgcccagggtaaa
aatttacctgaagccgatcttcccgaaggatggacgttaatgaaatggataaatgaagaa
gtgaaaaaacgttttccctggaagatcaccattgccgaagacctgcaggacaatgaatgg
atcactaaaggaacggaagataacggggaagggttcaatacccaatgggaccctgctttt
accttcagcgtgcgggatgttttgaaggtacctgaagatgagcaccgcgacctggacaag
atacaatttgccattaaccataattttaatggcgatgcctttcaacgggtgatctataca
gaatcgcacgatgatgtggccaatggtaaaacgcgggtaccggaagaaataacaccgggc
gatgcgcagagctggtttgccaaaaagcgatcggtgctgggggctgtgctggtttttacg
gcggccggcatacccatgattttccagggtcaggaatttgtggaaggcggctggtttgat
gacaccaggcctcttgactggtcgaagttcagcgactttaaaggtattgcccgcctgtac
cgcgattgtataagtttacggcgcaatatggaagggctcaccaaaggactatcgggccag
catacacgcatcatacatgtaaacaatgaagataaagtaatagcctttcaccgctggtac
gagggcggaccaaaagacagtaccattgttgttttgaactttatgaataaggagcataag
gactatgtgattggcgtaccggaagaaggggtatggaaagtacggttcaacagtgactgg
aaagggtatgatgaatcgtttactgatgcggctgtgtttgatgtggaaacgtttacaagc
agcaaagatgaacaggagttcagtatatccttaaacatgggaccttataatgcattgatc
ctttcaagggattaa

DBGET integrated database retrieval system