KEGG   Niastella koreensis: Niako_6440Help
Entry
Niako_6440        CDS       T01679                                 

Definition
maltooligosyl trehalose hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nko  Niastella koreensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nko00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7948190..7950004
Genome map
AA seq 604 aa AA seqDB search
MSKSTTAAAPEIHIEGMGSIPHENGVFFRVWAPHAKKVFVTGEFNNWSKNKHPMTHEGNG
YWGLNIPDAKAGNQYKYILQTDMGLLHRNDPYARELTNSAGNSIITDPHFEWTDHDFKMP
SWNELVIYEMHIGTFNVKEDGKPGTFETARQRLGYLKALGVNALEIMPATEFPGGISWGY
NLSHPYAIESDYGGVKGFKELINAAHELGIAIILDVVYNHFGPSDLDLWQFDGWSENGAG
GIYFYQDWRAETPWGHTRPDYGRPEVRQYLRDNALMWLEDYHIDGLRTDALLFVRNAQGK
NLPEADLPEGWTLMKWINEEVKKRFPWKITIAEDLQDNEWITKGTEDNGEGFNTQWDPAF
TFSVRDVLKVPEDEHRDLDKIQFAINHNFNGDAFQRVIYTESHDDVANGKTRVPEEITPG
DAQSWFAKKRSVLGAVLVFTAAGIPMIFQGQEFVEGGWFDDTRPLDWSKFSDFKGIARLY
RDCISLRRNMEGLTKGLSGQHTRIIHVNNEDKVIAFHRWYEGGPKDSTIVVLNFMNKEHK
DYVIGVPEEGVWKVRFNSDWKGYDESFTDAAVFDVETFTSSKDEQEFSISLNMGPYNALI
LSRD
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaagtactacagccgcagcaccggaaatccatatagaaggaatgggttccatc
cctcacgagaatggcgtattcttcagagtttgggcgccacatgcaaaaaaggtatttgtt
accggcgagtttaataactggtcaaagaataaacaccctatgacgcatgaaggcaatggg
tattggggcctgaatattcctgacgccaaagcagggaatcaatataaatacattctgcaa
acagatatgggtttgctgcaccgcaacgacccgtatgcaagggaattaaccaactccgcg
ggtaactccattatcaccgatccgcactttgaatggacggaccatgactttaaaatgcca
tcctggaatgagttggtgatctatgaaatgcacattggcacattcaatgtaaaggaagac
gggaagcccggtacttttgaaaccgcccggcaacggctggggtatttaaaagcgctgggt
gtgaacgcccttgaaatcatgcctgccaccgaatttccgggtggtatttcctgggggtat
aatttgtctcacccgtatgctattgaatcagattatggcggtgtaaagggttttaaagaa
ctcatcaatgctgcccatgaattggggattgccattattctggatgtggtgtataaccat
tttgggccttcagaccttgacctgtggcaatttgatggctggagcgagaatggagcaggt
gggatctacttctaccaggactggcgggctgaaacgccctggggccatacccggcccgat
tatgggcgccccgaagtcaggcagtacctgcgcgacaatgccctgatgtggctggaagat
tatcatatagacggcctgcgtaccgatgcgctgctttttgtgcggaatgcccagggtaaa
aatttacctgaagccgatcttcccgaaggatggacgttaatgaaatggataaatgaagaa
gtgaaaaaacgttttccctggaagatcaccattgccgaagacctgcaggacaatgaatgg
atcactaaaggaacggaagataacggggaagggttcaatacccaatgggaccctgctttt
accttcagcgtgcgggatgttttgaaggtacctgaagatgagcaccgcgacctggacaag
atacaatttgccattaaccataattttaatggcgatgcctttcaacgggtgatctataca
gaatcgcacgatgatgtggccaatggtaaaacgcgggtaccggaagaaataacaccgggc
gatgcgcagagctggtttgccaaaaagcgatcggtgctgggggctgtgctggtttttacg
gcggccggcatacccatgattttccagggtcaggaatttgtggaaggcggctggtttgat
gacaccaggcctcttgactggtcgaagttcagcgactttaaaggtattgcccgcctgtac
cgcgattgtataagtttacggcgcaatatggaagggctcaccaaaggactatcgggccag
catacacgcatcatacatgtaaacaatgaagataaagtaatagcctttcaccgctggtac
gagggcggaccaaaagacagtaccattgttgttttgaactttatgaataaggagcataag
gactatgtgattggcgtaccggaagaaggggtatggaaagtacggttcaacagtgactgg
aaagggtatgatgaatcgtttactgatgcggctgtgtttgatgtggaaacgtttacaagc
agcaaagatgaacaggagttcagtatatccttaaacatgggaccttataatgcattgatc
ctttcaagggattaa

DBGET integrated database retrieval system