KEGG   Niastella koreensis: Niako_6662Help
Entry
Niako_6662        CDS       T01679                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nko  Niastella koreensis
Pathway
nko00010  Glycolysis / Gluconeogenesis
nko00620  Pyruvate metabolism
nko00640  Propanoate metabolism
nko00680  Methane metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_6662
   00620 Pyruvate metabolism
    Niako_6662
   00640 Propanoate metabolism
    Niako_6662
  Energy metabolism
   00680 Methane metabolism
    Niako_6662
Enzymes [BR:nko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Niako_6662
Lipid biosynthesis proteins [BR:nko01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Niako_6662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEW02886
UniProt: G8TIN3
Position
8185705..8187621
Genome map
AA seq 638 aa AA seqDB search
MSYPYQIKTADQYKTAYEKSVNDPEGFWGEIASTFYWRKKWDKVLEWDFKKPTIKWFGGG
KLNITENCIDRHLETLGNKPAIIWESNDPEEHHRVLTYRDLHFKVCQFANVLKNNGVKKG
DRVCIYMGMVPELAIAVLACARIGAIHSVVFGGFSAQSIADRLQDAKAEFVVTCDGAFRG
NKEIPLKGVIDDALVQCPFVKRVIVLTRTRTAVSMIKGRDVWWEDEIKRVETQGNPECVA
EEMDAEDMLFILYTSGSTGKPKGVVHTVGGYMVYTNYSFVNVFQYQPGDVHFCTADIGWI
TGHSYIVYGPLSAGATSLMFEGVPTWPDAGRFWEIVDKYKVNVLYTAPTAIRSLMGFGLD
PLKGRSLDSLKVLGTVGEPINEEAWHWYDEHIGKKKCPIVDTWWQTETGGILISNLAGVT
PAKPAHATLPLPGVQPVLVDENGKEITGNSVSGNLCIKFPWPGILRTTYGDHERCRLNYF
ATYENLYFTGDGCLRDEVGNYRITGRVDDVLNVSGHRIGTAEVENAINMHAGVVESAVVG
YPHDIKGQGIYCFVIYQGAHGDDENLARKDITQTVARIIGAIAKPDKIQFVSGLPKTRSG
KIMRRILRKIAEGEVDKLGDTSTLLDPGVVDEIAKGRL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatccttatcagataaaaacagcagaccaatacaaaacggcgtacgaaaaaagt
gttaacgatcctgaaggcttctggggagaaatagcttctactttttactggcgtaaaaaa
tgggataaagtgctggagtgggattttaaaaagccaaccattaaatggtttggtggaggt
aaattgaatattaccgaaaactgcatcgatcgtcatctcgaaacattaggtaataaaccg
gctattatttgggagtcgaacgatcctgaagaacatcaccgggtattaacctatcgcgac
ctgcacttcaaagtgtgtcagtttgccaatgtgcttaagaacaacggcgttaaaaaaggc
gaccgggtttgtatctatatgggcatggtgcccgagctggcaatagcagtactggcctgt
gcacgcattggtgctattcactctgtagtgtttggcggctttagcgcacaaagcattgcc
gaccgcctgcaggatgcgaaggcagagtttgtagttacctgtgacggcgcctttcgtggt
aataaagaaattcccctgaaaggtgttatcgacgatgcactggtgcaatgcccctttgta
aaaagggtgattgttttaaccagaacccgcacggctgtatctatgataaaaggccgcgac
gtttggtgggaagatgagatcaaacgggtggaaacacagggtaaccccgaatgtgtagcg
gaagaaatggatgcggaagacatgttgtttattttatacacctccggttcaaccggtaag
ccaaaaggagtagtgcatactgttggtggttatatggtgtataccaattatagctttgta
aatgtatttcagtaccagcccggcgatgtgcatttttgtacggccgatatcggttggatc
accggccatagttatattgtttatggcccattaagcgccggcgctacttcgctgatgttt
gaaggcgtgcctacctggcccgatgccggcaggttttgggaaatcgtagacaaatacaaa
gtaaacgtattatatactgcacctacggccatccgctcattgatgggttttggcctggat
ccattaaaaggccgcagcctcgattcgctgaaagtactgggtactgtaggtgaacctatc
aatgaagaagcatggcattggtacgatgagcacatcggcaaaaagaaatgccccattgtt
gatacctggtggcaaactgaaaccggaggtattcttatttccaacttagcaggcgtaacc
cccgctaaaccagcccatgctaccctgccattaccaggcgtacagccggtactggtagat
gagaacgggaaagaaatcaccggcaattcggtgagtggtaatctttgtatcaaattcccc
tggccaggcatattgcgcactacctacggcgatcatgagcgttgccgcctgaactatttt
gctacctacgaaaacctgtattttaccggcgatggttgcttacgcgatgaagtgggcaat
taccgcataaccggccgcgtagatgatgtgctgaacgtgagcggtcaccgcattggtaca
gctgaagtggagaatgccattaacatgcatgccggggtggtggaaagtgcagtggttggt
tatccgcatgatattaagggacagggcatttattgctttgttatttaccagggcgcgcat
ggtgacgatgaaaacctggcccgcaaggatattacccaaaccgttgcacgcattattggc
gccattgccaagcccgataaaattcaatttgtaagcgggttgcctaaaacaagaagcggg
aagatcatgcgccgcatcttacgcaaaattgctgaaggtgaagtggataaactgggcgat
acttctaccttgctggatcctggtgtggtggatgaaatagcgaaaggaagattatag

DBGET integrated database retrieval system