KEGG   Niastella koreensis: Niako_6852Help
Entry
Niako_6852        CDS       T01679                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nko  Niastella koreensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Niako_6852
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Niako_6852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8388172..8389014
Genome map
AA seq 280 aa AA seqDB search
MWKEVINFANPYVANMVKNGAKNVATATNTIKRILITQPRPETDKSPYFELARKYSVELE
FQPFIRLEGIPAKEFRKQKIEIPNYTAVIFTSRNAIDHFFRICEEMKISISQDTKYFCIT
EAVALYLQKFILYRKRKVFYGADSTNKSMFDVINKHKENEKFLYPCSENQQDNEIVSWLK
ANNCEFATPFMYRTISCDVKELLTKTEYDIICFFTPSGVKSLFDNVPAYQQNGTRIGAFG
SNTSRAVEDAGLTLDIKAPAPQAPSMVAALEQYLAAHKKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgtggaaagaagttattaactttgcaaatccatacgtagctaatatggttaaaaacggg
gctaaaaacgtagcaacagctacaaacaccattaaaagaatcctgattactcaacccagg
ccggaaaccgataaatcaccgtacttcgaacttgccagaaagtacagtgttgaattggag
ttccagccattcatacgtcttgaaggtattcccgccaaagagttccgcaagcaaaagata
gaaatacctaattatacagctgtaatctttaccagtcgcaacgcaattgatcacttcttc
cgcatttgcgaggaaatgaagatcagtatttcgcaggatacgaagtatttctgcattact
gaagccgttgcattgtacttgcagaaatttatcctgtatcgcaagcgcaaggtgttttat
ggggccgatagtacgaacaagagcatgtttgatgtaataaacaaacataaagagaacgag
aagttcctgtacccctgttccgaaaatcagcaggataatgagattgtgagctggctgaaa
gcgaacaattgtgaatttgccaccccattcatgtaccgcactatcagttgcgatgtgaag
gagctgctgacaaaaaccgaatacgacatcatttgcttttttacccccagcggcgtaaaa
agtcttttcgataacgtgcctgcctatcaacagaacggcacccgcattggtgcgttcggc
agcaatacttcccgcgccgttgaagacgccggtttaaccctggatattaaggcgccggcc
ccacaggccccgtctatggtagcggcgttggaacagtacctggcagcgcataaaaagaaa
taa

DBGET integrated database retrieval system