KEGG   Candidatus Nitrosopumilus koreensis: NKOR_00960Help
Entry
NKOR_00960        CDS       T02304                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_00960
   00030 Pentose phosphate pathway
    NKOR_00960
   00051 Fructose and mannose metabolism
    NKOR_00960
   00052 Galactose metabolism
    NKOR_00960
   00500 Starch and sucrose metabolism
    NKOR_00960
   00520 Amino sugar and nucleotide sugar metabolism
    NKOR_00960
  Nucleotide metabolism
   00230 Purine metabolism
    NKOR_00960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NKOR_00960
Enzymes [BR:nkr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NKOR_00960
    5.4.2.8  phosphomannomutase
     NKOR_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
167205..168554
Genome map
AA seq 449 aa AA seqDB search
MAKFFGTNGIRGVFDEDFTLEFVHDMTLAIGTYFQKGPILIGYDGRDSSPVICKVVTSTL
NSIGIDCNVAGIVPTPCLEFAVKKLGYSGGIMITASHNPPQYNGIKPAASDGVEISREDE
LIIEDIYLQKNWIKNSTNYGSTKKEERAIDVYLNGIISQVNSKLIESKHFKVVLDLGNGA
QAVSAPNFCKMINCKTFLVNENIDGNFPGRGSEPTPQNLSELSKTVIRNNADVGIAFDGD
GDRSIFCDNKGNILTGDKSALLLTKHILSNHPNSLVVTCLNSGSNIEVLADQFDSKVIRT
KVGSVEVSRKMVPTDALIGFEENGGFMFGKHNQVRDGCMTLALMLDLLAVSSNSLYDEIS
NLPSSFTTKDKVACSPENVPKLISSLKDEFPNSDLTDGIKINIDSRNWVMIRPSGTEPIV
RVYAEAQSQEKLDNLMSEYLQKVKTIISR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattttttggtacaaatggaattcgtggtgtctttgatgaagattttacatta
gaatttgttcatgacatgactttggcaattggaacttattttcaaaaaggaccaatattg
attggatatgatggaagagattctagtccagttatttgtaaagttgtaacttctactctt
aattcaataggcattgattgtaatgttgcaggaattgttccaacaccctgtcttgaattt
gcagtaaaaaagttgggatattctggaggtatcatgattactgcctctcacaatcctcct
caatacaatggaatcaaacctgctgcatctgatggagtagaaatttcacgagaagatgaa
ttaattattgaggatatctatcttcaaaaaaattggattaaaaactctacaaattatggt
tctacaaaaaaagaagaacgtgcaattgatgtttatctaaatggaatcatttcacaagtt
aattctaaattaatagaatcaaaacatttcaaggttgttttggatttaggtaatggtgca
caggctgtatctgcccctaatttttgtaaaatgattaattgtaaaacatttcttgtaaac
gaaaatattgatggtaactttccaggacgtggttcagaacccactcctcaaaatctttca
gaattatcaaagactgtaattcgcaacaatgctgatgtggggatagcatttgatggtgat
ggtgatagaagtattttttgtgataataaaggaaatattttgacaggtgacaaatcggca
ttattgttaactaaacatatcttatctaaccatccaaactctttagttgttacatgtcta
aattctggttctaatattgaagttctggcagatcaatttgattctaaagtaattcgtaca
aaagttggaagtgttgaagtctcaagaaaaatggttccgacagatgctctaatagggttt
gaagagaatggtggattcatgtttggaaaacataaccaggttcgagatggatgcatgact
ttggcattgatgcttgatcttttagcagtatcttctaactcattgtatgatgaaatttct
aatcttccatcatcttttactacaaaagataaagtcgcatgttctcctgaaaacgttcca
aaactaatttcctctctaaaagacgaatttccaaattctgatcttactgatggtatcaaa
atcaatatagattcaagaaactgggttatgatccgacctagtggaacagaaccaattgtt
agagtgtatgcagaagctcaaagtcaggaaaaattagacaatttaatgtctgaatatctc
caaaaagttaagacaatcatttccagataa

DBGET integrated database retrieval system