KEGG   Candidatus Nitrosopumilus koreensis: NKOR_02535Help
Entry
NKOR_02535        CDS       T02304                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nkr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
443297..444109
Genome map
AA seq 270 aa AA seqDB search
MEIMLDGKTIAITRSRDDSAEFISLAEQNNATPIPLPTIELVSKGEKIVDEFLDSVKTYN
PDYSVFMSSKAVKLLFDTAKELGKLETLQLAIANTIVISVGPKTTIALEAQGIKVNHHPS
ETFSSVGVGELFTQLNAVGKKVIVPRSGASTPFLKELLNKIGIDVFEIHLYDVCAFRDTS
QWNEFRELFSQNKIDGVVFTSASSVRGFFEIMTKDYDKNTLLDNLEKLSVVSIGPFTSDE
LKKFKVKNTVAEVHTVAGAFDAMKNTLTVA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggaaataatgcttgatggaaaaactattgcaatcactcgttcacgagacgattctgct
gaattcatttcacttgctgagcaaaacaatgcaactcccataccattacctaccattgaa
cttgtaagcaaaggtgaaaaaattgttgatgaatttctagactctgttaaaacttacaat
cctgattattctgtttttatgagttctaaagcagtgaaattactatttgatactgcaaaa
gagttaggaaaactagaaacactacaattggcaattgcaaacacaattgttatttcagtt
ggtccaaaaactaccattgctcttgaagcacaaggaattaaagtcaatcatcatccttca
gaaacattttcctctgtaggtgttggagaattatttacacaactcaacgcagttggcaaa
aaagtcattgttccaagaagtggtgcatctactccatttctaaaggagttgctcaacaaa
attggaattgatgtttttgaaattcatttgtacgatgtttgtgcatttagagatacttct
caatggaacgaattcagagaattattctcccaaaacaagattgatggtgttgtgtttacc
agtgcctcttcagttagaggattttttgaaataatgactaaagattatgataaaaatact
ctattggataatcttgaaaaactttctgtagtttctattgggccattcacttcagatgaa
ttaaaaaaattcaaagtcaaaaatactgtggctgaagttcatactgttgcaggtgcattt
gatgcaatgaaaaacactctaactgttgcataa

DBGET integrated database retrieval system