KEGG   Candidatus Nitrosopumilus koreensis: NKOR_03005Help
Entry
NKOR_03005        CDS       T02304                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Brite
Enzymes [BR:nkr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NKOR_03005
Transfer RNA biogenesis [BR:nkr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NKOR_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(512498..514081)
Genome map
AA seq 527 aa AA seqDB search
MSKLDSIFSKACSEITQNLLIIDDPNKKQVKEEIKKICAKYSLERIPRNHEILSMAKESE
FNKLRKILLKKPAKTASGVAVVALMPKPYACPHGRCTYCPGGMEFNSPNSYTGNEPSTLN
AIENEYDPKLQITTKIDKLIAFGHDPSKMEIVIVGGTFLFMPKDYQENFIKSCYDALNGI
DSKNLQEAKSNNEHASIRNVGFTIETKPDFCKKEHVDWMLNYGITRIEIGVQSLQERVYD
IVNRGHNYNDVTESFQISKDAGYKIVAHMMPGLPTVTPKEDIEDFKKLFSDPQLRPDMLK
IYPSLVIENTPMYKEYKDGKYVPYSDEDMINVLTEVKKNVPKWIRIMRVQREISPNEIIA
GPKSGNLRQIVHQNLAKQGIKCKCIRCREAGLNKKSEPKDIKLNRIDYDSSGGKEVFLSY
EDKNESIYGFLRLRKPSKEAHRDEVGTDSCIVRELHVYGKSLKIGEKEKSEIQHSGLGKN
LMKEAEKISKEEFDVKKLLVISAVGTREYYQKLGYSLYGPYMSKTLN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagattcaatattttctaaggcatgcagcgaaatcactcaaaatttgcta
ataattgacgatcccaataaaaaacaagtcaaagaagaaatcaagaaaatatgtgccaaa
tattcactagaaagaatcccacgaaatcacgagatactttcaatggcaaaagaatcagaa
tttaacaaactcagaaaaattttacttaaaaaacctgcaaaaactgcatcgggtgttgca
gtagtagcattaatgccaaaaccatatgcatgtccacatggaagatgcacatattgtcct
ggaggaatggaatttaattctccaaacagctatacaggaaatgaaccatctacactaaac
gcaatagaaaacgaatatgacccgaaattacaaatcacaacaaaaattgataaattaatt
gcgtttggtcatgacccatcaaaaatggaaatcgtaattgttggaggaacatttcttttc
atgccaaaagactatcaagaaaattttatcaaatcatgttatgatgcattaaatggaata
gattcaaaaaatttgcaagaagcaaaatcaaacaacgaacacgcatcaataagaaatgtg
ggatttacaattgaaacaaaaccagatttttgtaagaaagaacatgttgactggatgtta
aattatgggataacaagaatagagatcggagttcaatccctacaagaaagagtttacgac
atagttaacagaggacataattataacgacgtaacagaatcatttcaaatttcaaaagat
gcagggtacaaaattgttgcacatatgatgccaggattaccaacagttaccccaaaagaa
gatattgaagattttaagaaattgttttcagacccgcagttacgtccagacatgctaaaa
atttacccatcactagtcattgaaaacactccgatgtacaaagaatacaaagatggaaaa
tatgtgccatattcagacgaagatatgatcaacgttctaacagaagttaagaaaaatgtt
ccaaaatggatcagaatcatgagggttcaaagagaaatttctcccaatgagattattgca
ggaccaaaatcaggtaatctaagacagattgtacatcaaaatttagcaaaacagggaata
aaatgcaaatgtatcaggtgtagagaggcaggattaaacaaaaaatcagaaccaaaagac
atcaaattaaacagaattgattatgactcttcaggtggcaaagaagtattcttatcttat
gaagacaaaaatgaatcaatttatggatttttgagattaagaaaaccaagtaaagaagca
cacagagacgaagttgggacagactcttgtattgtcagagaacttcatgtatatggcaaa
tcactaaagattggtgaaaaagaaaaaagtgagatacagcactcaggtctaggaaaaaac
ctaatgaaagaagcagaaaaaatttcaaaagaagaatttgatgtaaagaaattacttgta
attagcgcagttggcacaagagagtattatcaaaaattagggtattcgttatatgggcca
tacatgtccaaaacattgaactag

DBGET integrated database retrieval system