KEGG   Candidatus Nitrosopumilus koreensis: NKOR_03610Help
Entry
NKOR_03610        CDS       T02304                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NKOR_03610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_03610
   00620 Pyruvate metabolism
    NKOR_03610
   00640 Propanoate metabolism
    NKOR_03610
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NKOR_03610
   00680 Methane metabolism
    NKOR_03610
Enzymes [BR:nkr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NKOR_03610
Lipid biosynthesis proteins [BR:nkr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NKOR_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619436..621352
Genome map
AA seq 638 aa AA seqDB search
MSDTYDIGLGNHDVETRKKASSNFVSFWDEQAKNLTWFSPWSKTLDWNPPFAKWFVGGTI
NASYNALDVHQESKSQKPAILWEGENGDSRILTYSELLSQVQKFANVLKSLGVQKGDRVT
LYLPMIPELPIAMLACARIGAPHTVIFSGFSATSIRDRVDDSKSKIIITADGGYRRGKIV
PLKEVVDEAIQDFDFVKNVVVVQRTKNEILMTPKDKLWNELMDDASESCIPEKLDSTHPL
YILYTSGTTGKPKGVLHGTGGYLTHLYSTFKWAFDIKDYDVFFCTADIGWVTGHSYVVYA
PLLHGATEIMYEGAPDFPDASRMWDILQKYKATIFYTTPTALRMFMKFGDDIPNSFDLSS
LRLLGTVGEPINPEVWKWYFKTIGKEKCPIIDTWWQTETGGMLISPLPGLETIPLKPGSG
TLPIPGVNISVVDENGKDVASNTKGYLVVKNPWPGMLLTLWGNDEKYKTVYWSKYENCYY
PGDYALKDSDGYLWLLGRADDVLKVAGHRIGTAELESCIVSHEDVAESAVCGIPDEVKGE
VIIAFVVLKQNVTTDRKILEKKLIEKIRADIGAIATPKQIYFVTKLPKTRSGKIMRRLLK
AIGNNEKIGDISTLEDGAAVTEVQTAFDEIQKTIQESK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacctatgatattggtcttggaaatcatgacgttgaaactagaaaaaaggct
tcttctaattttgtttctttttgggatgaacaggcaaagaatctgacctggttttctcct
tggagtaaaacattggattggaaccctccttttgcaaaatggtttgttggaggcacgatt
aatgcctcgtataatgctctggatgtacatcaggaatcaaaatctcaaaaacctgcgata
ctttgggagggagaaaatggggattctaggattcttacatacagtgagctgttatctcag
gttcaaaaatttgcaaatgtactcaaatctttaggggtgcaaaaaggcgatcgtgtaact
ctgtatcttccaatgattcctgaattacctatcgcaatgttagcttgtgctagaattggg
gcgcctcacactgttatcttttcaggatttagtgcaacttctattagggacagagtcgat
gattcaaaatccaaaattataatcactgcagatgggggatatagacgtggaaaaattgtg
cctctcaaagaagtagttgatgaggcaatacaagattttgattttgtgaaaaatgttgta
gttgtacaaagaacaaaaaatgaaattttgatgacacctaaagacaaactgtggaatgaa
ttgatggatgatgcatcagaaagttgtattcctgaaaagctagacagcacacatcctctt
tacattttgtatacttcgggaaccactggaaaaccaaaaggtgttttgcatggaacaggc
gggtatcttactcatctttattccactttcaagtgggcatttgacattaaagactatgat
gtgtttttttgcactgctgacattggatgggttacaggacacagttatgttgtttatgca
ccgttattgcatggtgcaactgaaattatgtatgaaggtgcacctgattttccagatgca
tctaggatgtgggatatcttgcaaaaatacaaagcaactatcttttacacaacacctacc
gcactcagaatgtttatgaaatttggagatgatattccaaattcatttgatctttcttct
ctgagattacttggaacagtgggcgagccaattaatcctgaagtttggaaatggtacttc
aaaactattggtaaagaaaaatgtccaatcattgatacttggtggcagactgaaactggc
gggatgttgatttctcctttgcctgggctggagactattcctctaaagcctggttctgga
actcttcctattccaggtgtgaatatctctgttgtagatgaaaatggcaaagatgttgcc
tctaacacaaagggctatcttgtagtcaaaaatccgtggcctggaatgcttttgacattg
tggggtaatgatgaaaaatacaaaactgtgtactggtcaaaatatgaaaattgttactat
cctggtgattatgcactaaaggattctgatggatatctctggttgcttggacgagctgat
gatgtgctcaaagtagcgggtcatagaattggcactgcagaacttgaaagttgtattgtg
tctcatgaggatgttgcagaatctgctgtatgcggtattcctgatgaggttaaaggtgaa
gtaataattgcatttgttgtacttaaacaaaatgtcactaccgatagaaaaattttagaa
aaaaaattgatagaaaaaatcagagctgatattggtgcaattgcaacccctaagcaaatc
tattttgtaaccaaattgccaaagacgcgtagtggaaaaattatgagacggctgttaaaa
gcaattggaaataatgaaaagattggtgatatcagcacattggaagacggtgctgctgtg
actgaagtacaaactgcttttgatgagattcaaaaaacaattcaagaatcaaaataa

DBGET integrated database retrieval system