KEGG   Candidatus Nitrosopumilus koreensis: NKOR_03610Help
Entry
NKOR_03610        CDS       T02304                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NKOR_03610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_03610
   00620 Pyruvate metabolism
    NKOR_03610
   00640 Propanoate metabolism
    NKOR_03610
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NKOR_03610
   00680 Methane metabolism
    NKOR_03610
Enzymes [BR:nkr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NKOR_03610
Lipid biosynthesis proteins [BR:nkr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NKOR_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619436..621352
Genome map
AA seq 638 aa AA seqDB search
MSDTYDIGLGNHDVETRKKASSNFVSFWDEQAKNLTWFSPWSKTLDWNPPFAKWFVGGTI
NASYNALDVHQESKSQKPAILWEGENGDSRILTYSELLSQVQKFANVLKSLGVQKGDRVT
LYLPMIPELPIAMLACARIGAPHTVIFSGFSATSIRDRVDDSKSKIIITADGGYRRGKIV
PLKEVVDEAIQDFDFVKNVVVVQRTKNEILMTPKDKLWNELMDDASESCIPEKLDSTHPL
YILYTSGTTGKPKGVLHGTGGYLTHLYSTFKWAFDIKDYDVFFCTADIGWVTGHSYVVYA
PLLHGATEIMYEGAPDFPDASRMWDILQKYKATIFYTTPTALRMFMKFGDDIPNSFDLSS
LRLLGTVGEPINPEVWKWYFKTIGKEKCPIIDTWWQTETGGMLISPLPGLETIPLKPGSG
TLPIPGVNISVVDENGKDVASNTKGYLVVKNPWPGMLLTLWGNDEKYKTVYWSKYENCYY
PGDYALKDSDGYLWLLGRADDVLKVAGHRIGTAELESCIVSHEDVAESAVCGIPDEVKGE
VIIAFVVLKQNVTTDRKILEKKLIEKIRADIGAIATPKQIYFVTKLPKTRSGKIMRRLLK
AIGNNEKIGDISTLEDGAAVTEVQTAFDEIQKTIQESK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacctatgatattggtcttggaaatcatgacgttgaaactagaaaaaaggct
tcttctaattttgtttctttttgggatgaacaggcaaagaatctgacctggttttctcct
tggagtaaaacattggattggaaccctccttttgcaaaatggtttgttggaggcacgatt
aatgcctcgtataatgctctggatgtacatcaggaatcaaaatctcaaaaacctgcgata
ctttgggagggagaaaatggggattctaggattcttacatacagtgagctgttatctcag
gttcaaaaatttgcaaatgtactcaaatctttaggggtgcaaaaaggcgatcgtgtaact
ctgtatcttccaatgattcctgaattacctatcgcaatgttagcttgtgctagaattggg
gcgcctcacactgttatcttttcaggatttagtgcaacttctattagggacagagtcgat
gattcaaaatccaaaattataatcactgcagatgggggatatagacgtggaaaaattgtg
cctctcaaagaagtagttgatgaggcaatacaagattttgattttgtgaaaaatgttgta
gttgtacaaagaacaaaaaatgaaattttgatgacacctaaagacaaactgtggaatgaa
ttgatggatgatgcatcagaaagttgtattcctgaaaagctagacagcacacatcctctt
tacattttgtatacttcgggaaccactggaaaaccaaaaggtgttttgcatggaacaggc
gggtatcttactcatctttattccactttcaagtgggcatttgacattaaagactatgat
gtgtttttttgcactgctgacattggatgggttacaggacacagttatgttgtttatgca
ccgttattgcatggtgcaactgaaattatgtatgaaggtgcacctgattttccagatgca
tctaggatgtgggatatcttgcaaaaatacaaagcaactatcttttacacaacacctacc
gcactcagaatgtttatgaaatttggagatgatattccaaattcatttgatctttcttct
ctgagattacttggaacagtgggcgagccaattaatcctgaagtttggaaatggtacttc
aaaactattggtaaagaaaaatgtccaatcattgatacttggtggcagactgaaactggc
gggatgttgatttctcctttgcctgggctggagactattcctctaaagcctggttctgga
actcttcctattccaggtgtgaatatctctgttgtagatgaaaatggcaaagatgttgcc
tctaacacaaagggctatcttgtagtcaaaaatccgtggcctggaatgcttttgacattg
tggggtaatgatgaaaaatacaaaactgtgtactggtcaaaatatgaaaattgttactat
cctggtgattatgcactaaaggattctgatggatatctctggttgcttggacgagctgat
gatgtgctcaaagtagcgggtcatagaattggcactgcagaacttgaaagttgtattgtg
tctcatgaggatgttgcagaatctgctgtatgcggtattcctgatgaggttaaaggtgaa
gtaataattgcatttgttgtacttaaacaaaatgtcactaccgatagaaaaattttagaa
aaaaaattgatagaaaaaatcagagctgatattggtgcaattgcaacccctaagcaaatc
tattttgtaaccaaattgccaaagacgcgtagtggaaaaattatgagacggctgttaaaa
gcaattggaaataatgaaaagattggtgatatcagcacattggaagacggtgctgctgtg
actgaagtacaaactgcttttgatgagattcaaaaaacaattcaagaatcaaaataa

DBGET integrated database retrieval system