KEGG   Candidatus Nitrosopumilus koreensis: NKOR_04585Help
Entry
NKOR_04585        CDS       T02304                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00010  Glycolysis / Gluconeogenesis
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01120  Microbial metabolism in diverse environments
nkr01130  Biosynthesis of antibiotics
nkr01200  Carbon metabolism
nkr01230  Biosynthesis of amino acids
Module
nkr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_04585
Enzymes [BR:nkr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     NKOR_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_N Gp17 Semialdhyde_dh NAD_binding_3 Gp_dh_N DUF682 IlvN
Motif
Other DBs
NCBI-ProteinID: AFS80805
UniProt: K0B745
Position
761864..762916
Genome map
AA seq 350 aa AA seqDB search
MKKVFVNGYGSIGSRITSFLKDDPEISVIGVGKYSPDKDVDVAISRGLNVYVPQDKLTDF
NNFKISGSIETALDDCDLVIDAAPGGHGYKNKKNLYEPRNLSAIYQGGESTMGDNAVSDL
LFNSRANYDLAIGKNHVMQGSCNVTGMGRILEPLRDKFGDDLIRFDVTLVRRWADIEQTD
KKLSDTIEMTEKPHHGDDVKLYFGKDAPLYVRAIKVPTRQMHLHIMDIRFKETAPKPSEI
HELFANEFGVATLWTAKGTKDVRDYAQNMGFNFTDTNMIHIHANMTTSIGDTVQMMYSDD
QTGIVIPENHMLMQAMLFEKSYSEAFAHTESIFHMAEKKQKLQEHFAKKD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtatttgttaatggatatggttctattggaagtagaattacatcatttcta
aaagatgatcctgaaatatctgtcattggagttggaaaatactctcctgacaaagacgtg
gatgttgcaatttctagaggattgaatgtgtatgtacctcaagacaagttgactgatttt
aataattttaaaatttctggatcaattgaaactgctctagatgattgtgatcttgtaatt
gatgcagctcctggaggtcatggttacaaaaataaaaaaaatctctatgaaccacgtaac
ttatctgcaatatatcaaggtggagaatccacaatgggagataacgcagtttctgattta
ttgtttaattctagagctaactatgatcttgcaattggtaaaaatcatgtaatgcaaggt
agttgtaatgtaactggtatggggaggattcttgaaccattaagagacaagtttggtgat
gatcttattcgttttgatgtaactcttgttagaagatgggcagatattgaacaaacagat
aaaaaactttcagatactattgaaatgactgaaaaacctcatcatggggatgatgtaaaa
ttgtattttggaaaagatgctcctctttatgtacgagcaatcaaggtaccaactcgtcaa
atgcatttacacatcatggatattcgattcaaagaaactgctccaaagccttctgagatt
catgaactttttgcaaatgagtttggtgttgctacattgtggactgcaaaaggaacaaaa
gatgtaagagattatgctcaaaatatgggatttaattttactgatacaaacatgattcac
attcatgccaatatgaccacatccattggcgacacagtacagatgatgtattctgatgat
caaactggaattgttattcctgaaaatcacatgctgatgcaggcaatgttatttgaaaaa
tcatattctgaagcatttgcgcatacagaatcaatattccatatggcagaaaagaaacaa
aaattacaagagcattttgctaaaaaagattaa

DBGET integrated database retrieval system