KEGG   Candidatus Nitrosopumilus koreensis: NKOR_04585Help
Entry
NKOR_04585        CDS       T02304                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:nkr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nkr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nkr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761864..762916
Genome map
AA seq 350 aa AA seqDB search
MKKVFVNGYGSIGSRITSFLKDDPEISVIGVGKYSPDKDVDVAISRGLNVYVPQDKLTDF
NNFKISGSIETALDDCDLVIDAAPGGHGYKNKKNLYEPRNLSAIYQGGESTMGDNAVSDL
LFNSRANYDLAIGKNHVMQGSCNVTGMGRILEPLRDKFGDDLIRFDVTLVRRWADIEQTD
KKLSDTIEMTEKPHHGDDVKLYFGKDAPLYVRAIKVPTRQMHLHIMDIRFKETAPKPSEI
HELFANEFGVATLWTAKGTKDVRDYAQNMGFNFTDTNMIHIHANMTTSIGDTVQMMYSDD
QTGIVIPENHMLMQAMLFEKSYSEAFAHTESIFHMAEKKQKLQEHFAKKD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtatttgttaatggatatggttctattggaagtagaattacatcatttcta
aaagatgatcctgaaatatctgtcattggagttggaaaatactctcctgacaaagacgtg
gatgttgcaatttctagaggattgaatgtgtatgtacctcaagacaagttgactgatttt
aataattttaaaatttctggatcaattgaaactgctctagatgattgtgatcttgtaatt
gatgcagctcctggaggtcatggttacaaaaataaaaaaaatctctatgaaccacgtaac
ttatctgcaatatatcaaggtggagaatccacaatgggagataacgcagtttctgattta
ttgtttaattctagagctaactatgatcttgcaattggtaaaaatcatgtaatgcaaggt
agttgtaatgtaactggtatggggaggattcttgaaccattaagagacaagtttggtgat
gatcttattcgttttgatgtaactcttgttagaagatgggcagatattgaacaaacagat
aaaaaactttcagatactattgaaatgactgaaaaacctcatcatggggatgatgtaaaa
ttgtattttggaaaagatgctcctctttatgtacgagcaatcaaggtaccaactcgtcaa
atgcatttacacatcatggatattcgattcaaagaaactgctccaaagccttctgagatt
catgaactttttgcaaatgagtttggtgttgctacattgtggactgcaaaaggaacaaaa
gatgtaagagattatgctcaaaatatgggatttaattttactgatacaaacatgattcac
attcatgccaatatgaccacatccattggcgacacagtacagatgatgtattctgatgat
caaactggaattgttattcctgaaaatcacatgctgatgcaggcaatgttatttgaaaaa
tcatattctgaagcatttgcgcatacagaatcaatattccatatggcagaaaagaaacaa
aaattacaagagcattttgctaaaaaagattaa

DBGET integrated database retrieval system