KEGG   Candidatus Nitrosopumilus koreensis: NKOR_04595Help
Entry
NKOR_04595        CDS       T02304                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NKOR_04595
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NKOR_04595
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NKOR_04595
Enzymes [BR:nkr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NKOR_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(764319..765656)
Genome map
AA seq 445 aa AA seqDB search
MKGDAYLKCIDPQCGLEYPIESTIVHCDKGHLLDVKYKNAPSDNLKEVFDKRHNPHGSIF
NESGVWRFRELLNFCQIDTEDIEECSKYLVSLDGAEGRLSKPYHMSKAAEFVGISNENFW
LQPEGYNPSGSFKDNGMATAVTHAKMVGAKKIVCASTGNTSASAGMFAANEGINCDVYIP
SGQIAPGKLSQAYQFGAQILEIDGNFDDALKQSLDDAQNHDGYTVNSINPFRIEGQKTIP
FRVLEYLNWETPDWIVYPGGALGNTSSCGKALMELYEWGWIKKIPRIAVINSEGASTLSD
LYNGKFEGEELRWNKGKPNTELITRYYDYLDKEGIRPKTKATAIQIGRPANILKGLRALE
FTNGVVTTVSDSDMLDGMSVVGLNGFDCEMASGASVVGVKKLINEGVISKDDTVVGILTG
RQKDAMLPVDYHNNPQNKFANPPKN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagacgcttatctcaaatgtattgatccacaatgcggtttagagtatcctata
gaaagtacaattgtacattgtgataagggtcatctgcttgatgtaaaatacaaaaatgca
ccatctgacaatctaaaagaggtatttgacaaaagacataatcctcatggaagtattttt
aatgaaagtggggtttggcgatttagagagttactcaacttttgccagattgatacagaa
gacatagaagagtgttcaaaatatttagtttcacttgatggggcagaaggaagattatca
aagccataccacatgtcaaaagctgcagaatttgtagggatttccaatgaaaacttttgg
ctacaaccagaaggatacaatccaagtggttcattcaaagataatggaatggcaacggca
gtgactcatgcaaaaatggtaggtgcgaaaaagattgtttgtgcatcaactggaaacaca
tctgcatcagctggaatgtttgcagcaaatgaagggataaattgtgatgtatacattcct
tcaggacagattgccccaggaaaattaagtcaagcctatcaatttggagctcagatatta
gagattgatggaaattttgatgatgcattaaaacagtcattagatgatgcacaaaatcat
gacggatatactgtaaattctatcaatccatttagaatagaaggacaaaaaacaattcca
tttagagtgttagaatatttgaactgggaaacaccagattggattgtttatcctggagga
gcattaggaaatacatctagttgtggaaaagcattaatggaattatatgaatggggatgg
attaaaaaaattccaagaatcgcagtcataaattctgaaggtgcaagcacattatcggat
ttgtataatggtaaatttgaaggagaggagctgagatggaacaaaggaaaacctaacaca
gaattaattacaagatattatgattatttggataaagaaggtatacgaccaaaaacaaaa
gctactgcaattcaaattggaaggcctgcaaatattttgaaaggtttacgtgcattagaa
tttacaaatggtgtggtaacaactgtttcagattcagatatgcttgacggtatgtctgta
gtgggtcttaatggatttgattgtgagatggcatcaggagcctcggtagtaggcgttaag
aaattaatcaatgagggagttatcagtaaagatgacacagtagtaggaattcttacaggt
aggcaaaaagatgcaatgcttcctgtagattatcacaataatccacaaaataaatttgca
aatcctccaaaaaattag

DBGET integrated database retrieval system