KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05145Help
Entry
NKOR_05145        CDS       T02304                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NKOR_05145
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NKOR_05145
Enzymes [BR:nkr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NKOR_05145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
849903..850679
Genome map
AA seq 258 aa AA seqDB search
MAENILRKLVNNSQMAINDGVYEIESNLEKSNKDFIQIIKTNGHAPLITEIKFASPSLGK
IRTLTDPVSIASQMIAGGSKALSVLTQPHLFNGSPEYFMKVRQAVDVPMLMKDIMIDKIQ
IDAAKKIGADFMLVIQSLFDQKYLKDIDDFIAYGHKQGLQILLEVHTKQEFENALKTQAD
LIGINNRNLDTLEINLKTTEDILSGIEKTRPILSESGIDTPEDIQYLKKCGADAFLIGSS
IMKSENIEEQVRKLVNAY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatattcttagaaaactggtaaacaactcacaaatggcaattaatgatggg
gtttatgaaatagaatctaatttggaaaaatcaaacaaagactttattcaaattattaag
acaaatggacatgcacctctgattacagaaataaaatttgcatcaccttccctaggtaaa
atccgcacactcactgatcctgtaagcattgcatcccaaatgatagcaggaggttcaaaa
gcactatcggtgttgacgcaaccacacttgtttaatggatcccccgagtattttatgaaa
gtaagacaagcagtggatgttccaatgttaatgaaagacatcatgattgacaaaattcag
atagatgccgcaaaaaaaattggagcagactttatgttagtaattcaatcattgtttgat
caaaagtatctaaaagacattgatgattttatcgcatatggtcacaaacaaggactgcaa
attcttttggaagtacatacaaaacaagaatttgaaaatgccctaaaaacacaagcagac
ttaattggaattaacaatagaaatctagatacactagaaatcaatctaaagactactgaa
gacatcttgtcaggaattgaaaaaacaagacccattttatctgaaagcgggatagacaca
cctgaagacatacaatatctaaaaaagtgtggagcagacgcatttctaataggatcaagc
ataatgaaaagtgagaacattgaagaacaagtaagaaaattggtgaatgcgtattga

DBGET integrated database retrieval system