KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05145Help
Entry
NKOR_05145        CDS       T02304                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01130  Biosynthesis of antibiotics
nkr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NKOR_05145
Enzymes [BR:nkr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NKOR_05145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE FMN_dh His_biosynth ThiG Cellulase AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFS80915
UniProt: K0B7L4
Position
849903..850679
Genome map
AA seq 258 aa AA seqDB search
MAENILRKLVNNSQMAINDGVYEIESNLEKSNKDFIQIIKTNGHAPLITEIKFASPSLGK
IRTLTDPVSIASQMIAGGSKALSVLTQPHLFNGSPEYFMKVRQAVDVPMLMKDIMIDKIQ
IDAAKKIGADFMLVIQSLFDQKYLKDIDDFIAYGHKQGLQILLEVHTKQEFENALKTQAD
LIGINNRNLDTLEINLKTTEDILSGIEKTRPILSESGIDTPEDIQYLKKCGADAFLIGSS
IMKSENIEEQVRKLVNAY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatattcttagaaaactggtaaacaactcacaaatggcaattaatgatggg
gtttatgaaatagaatctaatttggaaaaatcaaacaaagactttattcaaattattaag
acaaatggacatgcacctctgattacagaaataaaatttgcatcaccttccctaggtaaa
atccgcacactcactgatcctgtaagcattgcatcccaaatgatagcaggaggttcaaaa
gcactatcggtgttgacgcaaccacacttgtttaatggatcccccgagtattttatgaaa
gtaagacaagcagtggatgttccaatgttaatgaaagacatcatgattgacaaaattcag
atagatgccgcaaaaaaaattggagcagactttatgttagtaattcaatcattgtttgat
caaaagtatctaaaagacattgatgattttatcgcatatggtcacaaacaaggactgcaa
attcttttggaagtacatacaaaacaagaatttgaaaatgccctaaaaacacaagcagac
ttaattggaattaacaatagaaatctagatacactagaaatcaatctaaagactactgaa
gacatcttgtcaggaattgaaaaaacaagacccattttatctgaaagcgggatagacaca
cctgaagacatacaatatctaaaaaagtgtggagcagacgcatttctaataggatcaagc
ataatgaaaagtgagaacattgaagaacaagtaagaaaattggtgaatgcgtattga

DBGET integrated database retrieval system