KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05155Help
Entry
NKOR_05155        CDS       T02304                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nkr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nkr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nkr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851850..852668
Genome map
AA seq 272 aa AA seqDB search
MSKIEEKFSELKEKKQKALISYIMAGFPNEKATISVVRGLVKGGVDIIELGFPFSDPLAD
GPVIQNASTISLDGGTKINKFFSLVKKIRKETDIPLVLMTYTNILYHRGYSKFITDAKKA
GIDGFILPDMSVEESKEYLQAAKNIADTIFLISPNTSKTRIQKIVKASSGFLYLVAVYGT
TGVKTGIKNYTIKAIKNVKKQTKGKIPIGVGFGVSTPEDVKKYINAGADGVIVGSAYLKL
IEKTPQSKLESKIESFTRSLKRQTLQKKIRTV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagattgaagaaaaattttcagagttaaaagaaaaaaagcaaaaagctttgatt
tcatacataatggcaggatttccaaatgaaaaagcaaccatatcggttgtaagaggattg
gtaaaaggaggagtagacatcatagaattgggatttcctttctcagatccactggcagat
ggtccagttattcaaaatgcaagtaccatatctcttgatggaggcacgaagataaacaaa
tttttttcactagtgaaaaaaatcagaaaagagacagacataccacttgtattgatgaca
tataccaacatcctataccatagagggtattcaaaattcatcacagatgcaaaaaaggca
gggattgacggattcattcttccagacatgtcagtagaagagtcaaaagaatatcttcaa
gctgctaaaaatattgcagataccatatttctgatatcacccaataccagtaaaacaaga
attcaaaaaattgtaaaagcatcatcaggtttcttgtatctagttgcagtgtatggaacc
accggagtaaaaacaggaattaaaaattatacaataaaggcaatcaaaaatgtcaaaaaa
caaaccaaaggaaagattccaataggagttggttttggggtatcgactccagaagacgta
aagaaatacatcaacgcaggagctgacggagtaattgtcggaagtgcatatttgaaatta
attgaaaagacacctcaaagcaaattagagtctaaaatagaatcatttacaagatctctg
aaaagacaaacattgcagaaaaaaataagaaccgtctaa

DBGET integrated database retrieval system