KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05155Help
Entry
NKOR_05155        CDS       T02304                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NKOR_05155
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NKOR_05155
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NKOR_05155
Enzymes [BR:nkr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NKOR_05155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
851850..852668
Genome map
AA seq 272 aa AA seqDB search
MSKIEEKFSELKEKKQKALISYIMAGFPNEKATISVVRGLVKGGVDIIELGFPFSDPLAD
GPVIQNASTISLDGGTKINKFFSLVKKIRKETDIPLVLMTYTNILYHRGYSKFITDAKKA
GIDGFILPDMSVEESKEYLQAAKNIADTIFLISPNTSKTRIQKIVKASSGFLYLVAVYGT
TGVKTGIKNYTIKAIKNVKKQTKGKIPIGVGFGVSTPEDVKKYINAGADGVIVGSAYLKL
IEKTPQSKLESKIESFTRSLKRQTLQKKIRTV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagattgaagaaaaattttcagagttaaaagaaaaaaagcaaaaagctttgatt
tcatacataatggcaggatttccaaatgaaaaagcaaccatatcggttgtaagaggattg
gtaaaaggaggagtagacatcatagaattgggatttcctttctcagatccactggcagat
ggtccagttattcaaaatgcaagtaccatatctcttgatggaggcacgaagataaacaaa
tttttttcactagtgaaaaaaatcagaaaagagacagacataccacttgtattgatgaca
tataccaacatcctataccatagagggtattcaaaattcatcacagatgcaaaaaaggca
gggattgacggattcattcttccagacatgtcagtagaagagtcaaaagaatatcttcaa
gctgctaaaaatattgcagataccatatttctgatatcacccaataccagtaaaacaaga
attcaaaaaattgtaaaagcatcatcaggtttcttgtatctagttgcagtgtatggaacc
accggagtaaaaacaggaattaaaaattatacaataaaggcaatcaaaaatgtcaaaaaa
caaaccaaaggaaagattccaataggagttggttttggggtatcgactccagaagacgta
aagaaatacatcaacgcaggagctgacggagtaattgtcggaagtgcatatttgaaatta
attgaaaagacacctcaaagcaaattagagtctaaaatagaatcatttacaagatctctg
aaaagacaaacattgcagaaaaaaataagaaccgtctaa

DBGET integrated database retrieval system