KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05385Help
Entry
NKOR_05385        CDS       T02304                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NKOR_05385
   01230 Biosynthesis of amino acids
    NKOR_05385
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_05385
   00051 Fructose and mannose metabolism
    NKOR_05385
   00562 Inositol phosphate metabolism
    NKOR_05385
Enzymes [BR:nkr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NKOR_05385
Exosome [BR:nkr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NKOR_05385
  Exosomal proteins of bladder cancer cells
   NKOR_05385
  Exosomal proteins of melanoma cells
   NKOR_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891862..892518
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEISGDKIIKFVKIAEKISKKFKIKIAICPPQHLIGVVANSSIPIFAQHVD
DSNVGSTTGFVIPELLKKSKVNGSLINHSEHRILSKEISKIVSKLKDLKMTSIVCVRDVA
EARKYAKLNPDYIAIEPPELIGSGKSVSTHRPELITKAAIAVKDAKNNTKLLCGAGIISG
KDVSKAVELGSKGILVASGIIKAKDWNKIISEFAKALV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaatcaattgtaaaaattatgaagaaatttcaggagacaaaatcattaaattt
gtaaaaattgctgaaaaaatttcaaaaaaatttaagataaaaattgcaatatgtccacct
cagcacctcataggagttgttgcaaatagttcaattccaatttttgcacaacatgttgat
gattccaatgtaggtagcacgacaggttttgtaataccagaattactaaaaaaatccaaa
gtaaatggatcattgatcaaccatagcgaacatagaattttatcaaaagagatttcaaaa
atagtatcaaagttaaaagatctgaaaatgacatcaattgtttgtgtgagagatgtagca
gaggcaagaaaatatgccaaactaaacccagattacattgcaatagaacctccagagctt
ataggttcaggaaaatcagtatcgactcatagaccagaactaataacaaaagctgcaatc
gcagtaaaagatgcaaaaaataacacaaaacttctttgtggtgcaggaattatttcagga
aaagatgtttcaaaagcagttgaattaggttcaaaaggaattctagttgcaagcggtata
atcaaagcaaaagattggaacaaaataatttctgaatttgccaaggcattagtttaa

DBGET integrated database retrieval system