KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05385Help
Entry
NKOR_05385        CDS       T02304                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NKOR_05385
   01230 Biosynthesis of amino acids
    NKOR_05385
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_05385
   00051 Fructose and mannose metabolism
    NKOR_05385
   00562 Inositol phosphate metabolism
    NKOR_05385
Enzymes [BR:nkr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NKOR_05385
Exosome [BR:nkr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NKOR_05385
  Exosomal proteins of bladder cancer cells
   NKOR_05385
  Exosomal proteins of melanoma cells
   NKOR_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891862..892518
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEISGDKIIKFVKIAEKISKKFKIKIAICPPQHLIGVVANSSIPIFAQHVD
DSNVGSTTGFVIPELLKKSKVNGSLINHSEHRILSKEISKIVSKLKDLKMTSIVCVRDVA
EARKYAKLNPDYIAIEPPELIGSGKSVSTHRPELITKAAIAVKDAKNNTKLLCGAGIISG
KDVSKAVELGSKGILVASGIIKAKDWNKIISEFAKALV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaatcaattgtaaaaattatgaagaaatttcaggagacaaaatcattaaattt
gtaaaaattgctgaaaaaatttcaaaaaaatttaagataaaaattgcaatatgtccacct
cagcacctcataggagttgttgcaaatagttcaattccaatttttgcacaacatgttgat
gattccaatgtaggtagcacgacaggttttgtaataccagaattactaaaaaaatccaaa
gtaaatggatcattgatcaaccatagcgaacatagaattttatcaaaagagatttcaaaa
atagtatcaaagttaaaagatctgaaaatgacatcaattgtttgtgtgagagatgtagca
gaggcaagaaaatatgccaaactaaacccagattacattgcaatagaacctccagagctt
ataggttcaggaaaatcagtatcgactcatagaccagaactaataacaaaagctgcaatc
gcagtaaaagatgcaaaaaataacacaaaacttctttgtggtgcaggaattatttcagga
aaagatgtttcaaaagcagttgaattaggttcaaaaggaattctagttgcaagcggtata
atcaaagcaaaagattggaacaaaataatttctgaatttgccaaggcattagtttaa

DBGET integrated database retrieval system