KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05775Help
Entry
NKOR_05775        CDS       T02304                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NKOR_05775
   01230 Biosynthesis of amino acids
    NKOR_05775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_05775
   00030 Pentose phosphate pathway
    NKOR_05775
   00051 Fructose and mannose metabolism
    NKOR_05775
  Energy metabolism
   00680 Methane metabolism
    NKOR_05775
Enzymes [BR:nkr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NKOR_05775
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NKOR_05775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964746..965891
Genome map
AA seq 381 aa AA seqDB search
MENMKITVSVIKADVGGIGGHTKPSDGLLDAIKNTVKNSADLLIDYYIGYCGDDTHIVMS
HTHGVDNQQIHKLAWDAFMAGTQVAKEEGLYGAGQDLLKDSFSGNVKGMGPGVAEMEFEE
RPNEAFTVFAADKTEPGAFNYPIYRMFVDALSNTGLIVNKNLAEGVKINIMDVEKAQIAE
LELWQDKPTIEAALMYPGRYVVDSVTTKDGEPILAASTDRLHNIAGTYVGKDDPICVVRT
QKRFPATEEVGSVFNNPHFVAGNTRGSHNMPLMPVKLNSAATINFCIPIVESLVFSMHNG
KFTGPFDGFSTPDWDLIRERATEKAMAIRSQGFIHPATLVPSELEYAEGYRARMDVLESK
MKPMEGTTSSGEKKENYEDPD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgaaaattacagtttcagttatcaaagccgatgtcggcgggatcggagga
catacaaaacctagtgacggattattagacgcaattaaaaataccgtcaaaaattcagca
gatttgcttattgattattacataggatattgcggagatgacacacatattgtaatgtcc
catactcatggagtagacaatcaacagattcacaaattagcatgggatgcattcatggca
ggaactcaagtcgcaaaagaagagggactgtatggtgcaggacaagatttactcaaagac
tctttttcaggaaatgtgaaaggaatgggtccaggagtcgcagagatggaatttgaagaa
agaccaaacgaggcatttacagtgtttgcagctgataagacagaaccaggagcatttaac
tatccaatctacagaatgtttgttgacgcattaagcaacacaggattaattgtaaacaag
aatcttgcagaaggagttaaaatcaacatcatggatgttgaaaaagctcagattgcagaa
ttagaattatggcaagacaaaccaacaattgaagctgcattaatgtatccaggaagatat
gtcgtagattcagtcactacaaaagatggggagccaattctagctgcatcaactgataga
ttacataacattgcaggaacatatgttggaaaagacgatccaatctgtgtcgttagaaca
caaaaaagattcccagcaactgaagaagtgggcagtgtctttaacaatccgcactttgtt
gcaggaaacacaaggggaagtcacaacatgcccttaatgcctgtaaaactaaactcagct
gcaacaatcaacttttgcattccaatagtcgaatcacttgtgtttagcatgcacaatgga
aagtttactggtccatttgacgggttctcaaccccagactgggatctaattagagaaaga
gccacagaaaaagcaatggcaatcaggagtcaaggattcatacatccagcaacacttgtt
ccatccgagttagaatatgctgaaggatatagagcaagaatggatgttcttgaaagtaaa
atgaagccaatggaaggaaccacatctagtggcgagaagaaagagaattacgaagatcca
gactag

DBGET integrated database retrieval system