KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05775Help
Entry
NKOR_05775        CDS       T02304                                 

Definition
(GenBank) hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00010  Glycolysis / Gluconeogenesis
nkr00030  Pentose phosphate pathway
nkr00051  Fructose and mannose metabolism
nkr00680  Methane metabolism
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01120  Microbial metabolism in diverse environments
nkr01130  Biosynthesis of antibiotics
nkr01200  Carbon metabolism
nkr01230  Biosynthesis of amino acids
Module
nkr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_05775
   00030 Pentose phosphate pathway
    NKOR_05775
   00051 Fructose and mannose metabolism
    NKOR_05775
  Energy metabolism
   00680 Methane metabolism
    NKOR_05775
Enzymes [BR:nkr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NKOR_05775
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NKOR_05775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AFS81038
UniProt: K0B4E9
Position
964746..965891
Genome map
AA seq 381 aa AA seqDB search
MENMKITVSVIKADVGGIGGHTKPSDGLLDAIKNTVKNSADLLIDYYIGYCGDDTHIVMS
HTHGVDNQQIHKLAWDAFMAGTQVAKEEGLYGAGQDLLKDSFSGNVKGMGPGVAEMEFEE
RPNEAFTVFAADKTEPGAFNYPIYRMFVDALSNTGLIVNKNLAEGVKINIMDVEKAQIAE
LELWQDKPTIEAALMYPGRYVVDSVTTKDGEPILAASTDRLHNIAGTYVGKDDPICVVRT
QKRFPATEEVGSVFNNPHFVAGNTRGSHNMPLMPVKLNSAATINFCIPIVESLVFSMHNG
KFTGPFDGFSTPDWDLIRERATEKAMAIRSQGFIHPATLVPSELEYAEGYRARMDVLESK
MKPMEGTTSSGEKKENYEDPD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgaaaattacagtttcagttatcaaagccgatgtcggcgggatcggagga
catacaaaacctagtgacggattattagacgcaattaaaaataccgtcaaaaattcagca
gatttgcttattgattattacataggatattgcggagatgacacacatattgtaatgtcc
catactcatggagtagacaatcaacagattcacaaattagcatgggatgcattcatggca
ggaactcaagtcgcaaaagaagagggactgtatggtgcaggacaagatttactcaaagac
tctttttcaggaaatgtgaaaggaatgggtccaggagtcgcagagatggaatttgaagaa
agaccaaacgaggcatttacagtgtttgcagctgataagacagaaccaggagcatttaac
tatccaatctacagaatgtttgttgacgcattaagcaacacaggattaattgtaaacaag
aatcttgcagaaggagttaaaatcaacatcatggatgttgaaaaagctcagattgcagaa
ttagaattatggcaagacaaaccaacaattgaagctgcattaatgtatccaggaagatat
gtcgtagattcagtcactacaaaagatggggagccaattctagctgcatcaactgataga
ttacataacattgcaggaacatatgttggaaaagacgatccaatctgtgtcgttagaaca
caaaaaagattcccagcaactgaagaagtgggcagtgtctttaacaatccgcactttgtt
gcaggaaacacaaggggaagtcacaacatgcccttaatgcctgtaaaactaaactcagct
gcaacaatcaacttttgcattccaatagtcgaatcacttgtgtttagcatgcacaatgga
aagtttactggtccatttgacgggttctcaaccccagactgggatctaattagagaaaga
gccacagaaaaagcaatggcaatcaggagtcaaggattcatacatccagcaacacttgtt
ccatccgagttagaatatgctgaaggatatagagcaagaatggatgttcttgaaagtaaa
atgaagccaatggaaggaaccacatctagtggcgagaagaaagagaattacgaagatcca
gactag

DBGET integrated database retrieval system