KEGG   Candidatus Nitrosopumilus koreensis: NKOR_06810Help
Entry
NKOR_06810        CDS       T02304                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NKOR_06810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_06810
  Lipid metabolism
   00071 Fatty acid degradation
    NKOR_06810
  Amino acid metabolism
   00350 Tyrosine metabolism
    NKOR_06810
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NKOR_06810
   00626 Naphthalene degradation
    NKOR_06810
Enzymes [BR:nkr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NKOR_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134369..1135403
Genome map
AA seq 344 aa AA seqDB search
MDKMRAMVLERCGAIETNPLKLTQIDRHEIKRPNEILLKIEACGVCHSQLHGIEGDWQDI
GIPPQLPTVPGHEVVGKVIEIGRDVTKFKVGDRAGITPLLEACKKCQYCKEGKEYLCESS
TITGESFKGGYTEYITVTEDFATKVPENMKPEYAAPLFCAGITAYKAVKAAEPQTHKKIG
IFGIGGVGHMAVQFAKIKDCDVIAFSRSQNHLDVAKRLGAVDAIKFSDNQEEFLKKLKEK
HGMLDAAIVFAPADIVTDTAIKAVKKGGLIVLATVGENPQFMAFEEKTIRGTLIGSTADM
EEVIKICSEKNIEVITETFPLESANKVLKKLKDSEIEARAVLIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatgcgcgcaatggtacttgagagatgtggagcaattgaaacaaatccatta
aagctaacccaaattgacagacatgagattaaaaggccaaatgagattttgcttaaaatt
gaagcatgtggagtttgtcattcgcagcttcacggcatagaaggagattggcaagatatt
ggaattccaccacaattgccaacagttccaggacatgaagttgtaggaaaggtgatagag
ataggaagagatgtcacaaaattcaaagtaggagatagagcaggaattactccattgcta
gaagcatgcaaaaaatgccaatattgcaaagaaggaaaagagtatctttgtgaatcatct
acaattacaggagaatctttcaagggaggatatacagaatacattacagttacggaagat
tttgcaacaaaagttcctgaaaatatgaaaccagaatatgctgcaccgttattttgtgca
ggaattacagcatacaaagcagtaaaagcagcagaacctcaaactcataaaaaaataggg
attttcggaatcggcggagtaggacacatggcagtacaatttgcaaaaataaaggattgt
gatgtgatagcattttcaaggtcacaaaatcaccttgatgttgcaaaaagattaggggca
gttgatgcaataaaattttctgataatcaagaagagtttttaaaaaaattaaaggaaaaa
cacggaatgcttgatgctgcaatcgtttttgcacctgcagatatagtcacagacacagct
atcaaagcagtaaagaaaggaggactcatagtacttgcaactgtcggagaaaatccacaa
ttcatggcatttgaagagaaaaccattagagggacattaattggttcgactgcagatatg
gaagaagtaatcaaaatatgcagtgaaaaaaatattgaagtaattacagaaacattccca
ttagaaagtgcaaataaagttcttaaaaaattaaaagattcagagattgaagctagggca
gttttaattccttga

DBGET integrated database retrieval system