KEGG   Candidatus Nitrosopumilus koreensis: NKOR_06810Help
Entry
NKOR_06810        CDS       T02304                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00010  Glycolysis / Gluconeogenesis
nkr00071  Fatty acid degradation
nkr00350  Tyrosine metabolism
nkr00625  Chloroalkane and chloroalkene degradation
nkr00626  Naphthalene degradation
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
nkr01120  Microbial metabolism in diverse environments
nkr01130  Biosynthesis of antibiotics
nkr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NKOR_06810
  Lipid metabolism
   00071 Fatty acid degradation
    NKOR_06810
  Amino acid metabolism
   00350 Tyrosine metabolism
    NKOR_06810
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NKOR_06810
   00626 Naphthalene degradation
    NKOR_06810
Enzymes [BR:nkr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NKOR_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C AlaDh_PNT_C CoA_binding ADH_zinc_N_2 DUF1460 NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFS81235
UniProt: K0B8D0
Position
1134369..1135403
Genome map
AA seq 344 aa AA seqDB search
MDKMRAMVLERCGAIETNPLKLTQIDRHEIKRPNEILLKIEACGVCHSQLHGIEGDWQDI
GIPPQLPTVPGHEVVGKVIEIGRDVTKFKVGDRAGITPLLEACKKCQYCKEGKEYLCESS
TITGESFKGGYTEYITVTEDFATKVPENMKPEYAAPLFCAGITAYKAVKAAEPQTHKKIG
IFGIGGVGHMAVQFAKIKDCDVIAFSRSQNHLDVAKRLGAVDAIKFSDNQEEFLKKLKEK
HGMLDAAIVFAPADIVTDTAIKAVKKGGLIVLATVGENPQFMAFEEKTIRGTLIGSTADM
EEVIKICSEKNIEVITETFPLESANKVLKKLKDSEIEARAVLIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatgcgcgcaatggtacttgagagatgtggagcaattgaaacaaatccatta
aagctaacccaaattgacagacatgagattaaaaggccaaatgagattttgcttaaaatt
gaagcatgtggagtttgtcattcgcagcttcacggcatagaaggagattggcaagatatt
ggaattccaccacaattgccaacagttccaggacatgaagttgtaggaaaggtgatagag
ataggaagagatgtcacaaaattcaaagtaggagatagagcaggaattactccattgcta
gaagcatgcaaaaaatgccaatattgcaaagaaggaaaagagtatctttgtgaatcatct
acaattacaggagaatctttcaagggaggatatacagaatacattacagttacggaagat
tttgcaacaaaagttcctgaaaatatgaaaccagaatatgctgcaccgttattttgtgca
ggaattacagcatacaaagcagtaaaagcagcagaacctcaaactcataaaaaaataggg
attttcggaatcggcggagtaggacacatggcagtacaatttgcaaaaataaaggattgt
gatgtgatagcattttcaaggtcacaaaatcaccttgatgttgcaaaaagattaggggca
gttgatgcaataaaattttctgataatcaagaagagtttttaaaaaaattaaaggaaaaa
cacggaatgcttgatgctgcaatcgtttttgcacctgcagatatagtcacagacacagct
atcaaagcagtaaagaaaggaggactcatagtacttgcaactgtcggagaaaatccacaa
ttcatggcatttgaagagaaaaccattagagggacattaattggttcgactgcagatatg
gaagaagtaatcaaaatatgcagtgaaaaaaatattgaagtaattacagaaacattccca
ttagaaagtgcaaataaagttcttaaaaaattaaaagattcagagattgaagctagggca
gttttaattccttga

DBGET integrated database retrieval system