KEGG   Candidatus Nitrosopumilus koreensis: NKOR_07970Help
Entry
NKOR_07970        CDS       T02304                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr00250  Alanine, aspartate and glutamate metabolism
nkr01100  Metabolic pathways
nkr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NKOR_07970
Enzymes [BR:nkr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NKOR_07970
Peptidases [BR:nkr01002]
 Cysteine Peptidases
  Family C44
   NKOR_07970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase NAD_synthase QueC ATP_bind_3 DUF2683 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AFS81455
UniProt: K0B927
Position
complement(1320953..1321708)
Genome map
AA seq 251 aa AA seqDB search
MDAKYQELFEKIKNSISQTVKENKIGIAFSGGVDSTLIAKICSDMNYDITLLTIGFSESH
DILFAKQVNEQLNYPHHILEIDSETFPSISSTIHEKIKTDNLSWNENCIAFYYVSKLAKS
LGLETVVTANGIDELFCGYNAYREAFSGGESKINEVMTSKLDNELKMMKAVNLIASEFNV
QILQPLLSPEFIDFAKTIPISEKILDSEDLYRKHIIRKLASVIGVPELSCTKRKKALQYG
SKIHKSLLKTR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggacgctaaataccaagagttatttgaaaaaatcaaaaattcaatttctcaaactgta
aaagaaaacaaaattggaattgctttttctggaggtgttgatagtactctaattgcaaaa
atttgctcagacatgaactatgatattactttgcttactattggattttctgaatcacat
gacatcttatttgcaaaacaggtcaatgaacaattgaattaccctcatcatatattagaa
attgattcagaaactttcccatctatttcgtccactattcatgaaaaaataaaaactgat
aatctttcatggaacgaaaattgtattgcgttttattatgtatcaaaacttgcaaaaagt
ttgggccttgaaacagtagttactgcaaacggaattgacgagttgttttgtggctataat
gcatatcgagaagcgttttcaggaggtgaatcaaaaatcaatgaagtaatgacgtcaaaa
ctagataatgaattaaagatgatgaaggcagtaaatcttattgcatctgaatttaatgta
caaatcctgcaaccactgctttctcctgagttcattgactttgcaaaaactattccaatc
tctgaaaaaattttagactctgaagatttgtacagaaaacacatcatacgaaaattggca
agtgtgattggtgttcctgaattgtcttgtactaaaagaaagaaagcactacaatatggt
tcaaaaattcacaaatcccttctaaagactagatga

DBGET integrated database retrieval system