KEGG   Candidatus Nitrosopumilus koreensis: NKOR_08425Help
Entry
NKOR_08425        CDS       T02304                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NKOR_08425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NKOR_08425
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NKOR_08425
Enzymes [BR:nkr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NKOR_08425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1408499..1409713)
Genome map
AA seq 404 aa AA seqDB search
MARTSLQCRECKKQYDTAFKYICDDCFGPLDVKYDFPTVTKDTFSNREHTYWRYFELLPI
ESKSNIVSIDAGMTPLTKAENLGKKLGLNNLYIKNDSVNPTFSFKDRPAGVAISKAKEFG
LSAVGCASTGNLASATAAHAAKGGFPCHVFAPSNIEMAKIAQALSYGANYVAVDGTYDDA
NRIAAQIGDSKGIGIVNINMRSHYVEGSKTLAYEVAEQLEWSVPDQLIVPVGSGAMLNAI
CKGFEELQNVSLLGDVSNMHMIAAQPHGCAPVVDAFKKKSKDVIPVENPDTIAKSLAIGD
PGDGRYVLKRLEQYNGFAEECNNKEILDAILLLAKTEGIFTEPAGGVSVSVLQKMVEQGK
IDKNDKVVCYVTGNGLKATESIMEVLQKPKVLKADISEISAVVN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggctagaacatcactacaatgcagagaatgcaaaaaacagtatgatactgctttcaag
tatatttgtgatgattgttttggccccttagatgtgaaatatgattttccaactgttacc
aaagataccttttctaatcgtgaacatacgtattggagatatttcgaattacttccaata
gaatcaaaatcaaacattgttagtattgatgctggaatgactccattaacaaaagcagaa
aacttgggtaaaaaacttggactcaataatctatacataaaaaatgattctgtaaatcct
acattttcattcaaagatagacctgcaggtgtcgcaatatcaaaagcaaaagaatttgga
ttgtctgcagttggctgtgcatcaactggcaatttagcatcagccactgcagctcatgca
gcaaaaggtggttttccgtgtcatgtatttgcaccaagcaatattgaaatggcaaagatt
gcacaagccttgtcttatggtgcaaactatgttgcagttgatggaacatatgatgatgca
aacagaattgcagcacaaattggtgactctaagggaattgggattgtaaatattaacatg
cgttcacattatgtagaaggctctaaaactttggcatatgaagttgcagaacaacttgaa
tggagtgtacctgatcaactaattgttccagttggtagtggtgcaatgcttaatgcaatt
tgtaaaggctttgaagaattacaaaatgtctcattacttggtgatgtatctaacatgcac
atgattgcagcacaaccacatggttgtgcacctgttgttgatgcattcaagaaaaaatct
aaagatgtaatcccagttgagaatcctgatactattgcaaaaagtttggcaataggtgat
cctggagatggacgatatgtgttaaaaagattagaacaatacaatgggtttgctgaagaa
tgtaacaacaaagaaattctagatgcaatacttctcttggccaaaactgaaggaatattt
acagaacctgctggaggagtttctgtttctgtattgcaaaaaatggtagaacaaggtaag
attgacaaaaatgataaggttgtatgttatgtaactggaaatggtcttaaagcaactgaa
tctattatggaagtactacaaaaaccaaaagtactcaaagcagatatctcagaaatttcg
gcggtagtaaactaa

DBGET integrated database retrieval system