KEGG   Candidatus Nitrosopumilus koreensis: NKOR_08470Help
Entry
NKOR_08470        CDS       T02304                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NKOR_08470
  Amino acid metabolism
   00340 Histidine metabolism
    NKOR_08470
Enzymes [BR:nkr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NKOR_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1415566..1416828)
Genome map
AA seq 420 aa AA seqDB search
MKIISINNPEQFLKKIGTKNSSKNQKIVESILNDVKNNGDTALKKYEKKFGAGKISSLRV
SQREITSAYSKVSAKDISAIKLAKSRLSKAESAIKRQFKDITIKFDGTKLSKSFVPIDSV
GCYVPGGMARYPSSAVMSVTPAQIAGVKRIVVVSPPNSLGNIDPLTIVAADICGATEIYK
TGGAQSIAALTYGTPSIKKVDKIVGPGGAFVTLAKYLVSNIVSIDMMAGPTELGIVIDSA
TDADLAALDLISQAEHSSDTFCYALTTSNSIAKKIQSSVNSKLQNIQRSKIVKSSLESNG
FIGVCKASDIVNIVNDLAPEHLEIMSKNVKKWNKIKNPGLVLLGKNSPSSASDYLLGSNH
ILPTNGFGKTRGSLSVLDFVKLLTKVETSKKDLQKISKSMQDLTLAEGLPNHYEAVRGRL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatttcaattaataacccagagcagtttctaaagaaaataggcacaaaaaac
tcttcaaaaaaccagaaaattgtagaatctatactcaacgatgtaaaaaataatggtgat
actgcacttaaaaaatatgaaaaaaagtttggagcaggtaaaatttcgtcattaagagtt
tcacaacgtgaaattactagtgcatactctaaagtttcagcaaaggatatctctgcaatc
aaactcgcaaaatcaagattatcaaaagcagaatctgcaataaaacgtcagttcaaagat
attacaataaaatttgatggaacaaaactctcaaaatcctttgttccaattgatagcgtt
ggatgttatgtgccaggtggaatggcaagatatccaagttctgctgtaatgtctgttact
cctgcacaaattgcaggtgtgaaaagaatagttgtagtatctccacctaactctttagga
aatatagatccattaacgattgtggcagctgatatttgtggcgcaactgaaatttacaaa
actggtggtgcacaatcaatagcagcattaacatatgggacaccttctatcaaaaaagta
gataagattgtaggacctggtggtgcatttgttactttagcaaaatatctggtaagcaat
attgtatccatagacatgatggcaggtccaactgaactaggaattgtcattgattctgca
acagatgctgatcttgcagcactagatcttatttcacaagcagaacactcttcagataca
ttttgttatgcactgactacctcaaactcaattgcaaagaaaatccaatctagtgtaaat
tctaaactccaaaatattcagcgctcaaagattgtaaaatctagtcttgaatcaaatgga
ttcattggtgtgtgtaaggcatctgatattgtcaatattgtaaatgatctggcacctgag
cacttggagattatgagcaaaaatgttaaaaaatggaataaaatcaaaaatcctggatta
gttttactcggaaaaaacagtccatcttctgcaagtgattatttactaggctcaaatcac
atattaccaacaaacggatttggcaaaactcgaggttccttatctgtattagattttgta
aaactcttaaccaaagtagaaactagcaaaaaagatttacagaaaatatcaaaatctatg
caggatctcactttagcagaaggattgccaaatcactatgaggcagtaaggggtagattg
taa

DBGET integrated database retrieval system