KEGG   Candidatus Nitrosopumilus koreensis: NKOR_08970Help
Entry
NKOR_08970        CDS       T02304                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NKOR_08970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NKOR_08970
Enzymes [BR:nkr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NKOR_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1497020..1497949)
Genome map
AA seq 309 aa AA seqDB search
MNEFYQRDIISIKDFGKDQLEKIFTATDKIMQLNPSDRREICKGNTLAYLFYEPSTRTRL
SFDSAMASVGGNSLGISDINSSSTQKGESLADTVRIMSIYSDILVLRHTLDGSSRFAAEV
SDKPVINAGSGTEEHPTQAIQDLFTIKKEKKKIDGLKIGIIGDLKYGRTVYSLLHGLGNY
DVDIKLISPESLRIRSDSTYEIKKKLDFTESTKIEDHIDELDVLYVTRIQKERFPDEEEY
LKVKGSYVVGLDLLKQMKEDSIILHPLPRIDEISTDIDQTKNAKYFEQAEYGKYTRAALL
GLTLNENGF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagttctatcaaagagacataatctcaattaaagactttggcaaagatcaacta
gaaaaaatctttaccgctactgataaaatcatgcaactaaacccctctgacagacgagaa
atctgtaagggcaacacattagcatatctgttctatgaaccaagtaccagaacccgtctt
agctttgattctgcaatggcatctgttggtggcaattctctaggaatttctgatattaat
tcgtcatcaactcagaaaggtgaaagtctagctgatactgttagaataatgtctatctat
tctgacatacttgttttgcgacatactcttgatggttctagtagatttgcagctgaagtt
tcagacaaacctgtcatcaatgccggcagcggaactgaagaacacccaactcaagcaatt
caagatctgtttaccatcaaaaaagaaaagaaaaagattgatggactaaaaattggaatc
ataggtgacctaaagtatggaagaactgtttattcacttttgcatggattgggaaactat
gatgttgacataaaattaatttccccagaatcacttagaatcaggtctgactctacttat
gaaattaaaaagaaattggattttactgaatcaactaaaattgaagaccacattgatgaa
cttgatgttttgtatgtgacaagaattcaaaaagaaagattccctgatgaagaagaatat
ctcaaagtaaagggaagttatgttgtagggctagatttactcaaacaaatgaaagaagac
agtataattttacaccctcttccaagaattgatgagatttcaacagacatcgatcaaaca
aaaaatgcaaagtattttgagcaggcagaatatggaaaatatactcgtgctgcattactg
ggtttgacattaaatgaaaatggcttttaa

DBGET integrated database retrieval system