KEGG   Candidatus Nitrosopumilus koreensis: NKOR_09775Help
Entry
NKOR_09775        CDS       T02304                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NKOR_09775
Enzymes [BR:nkr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NKOR_09775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1625483..1626040
Genome map
AA seq 185 aa AA seqDB search
MDEDRVKKLVRELIIEVGEDPTREGLRETPERIANMYKEIFSGYDSDSELAVQFSEDSDV
VIARDIQFYSMCEHHMLPFFGKIHIAYSPNGRVFGISKLVRLVEKYSKRLQIQERLTKNI
ADELYSQGVKGVVVLADAEHLCMKMRGVRNDATLSSSAFRGIYENKEEKESIMTLIRKRA
SDSSF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaccgggtaaagaaactcgtcagagaattaatcattgaagttggagaagat
ccaactcgtgagggcctacgtgaaactcctgaaagaattgcaaacatgtacaaagaaatc
ttttctggatatgattctgattcagagttggctgttcagttctcagaagattctgatgta
gttattgcacgtgatatccagttttactcaatgtgtgaacatcacatgcttccgttcttt
ggtaaaatacacattgcatattcaccaaatggaagagtttttggaatttcaaaactagta
agactagtagaaaaatactcaaagagactccaaatacaagaacgactaacaaagaatatt
gcagatgaattgtattctcagggtgtaaaaggagtggtagttttagctgatgcagaacat
ctttgtatgaaaatgcgtggtgttagaaatgatgcaacactttcctcatcagcatttaga
ggaatttatgaaaataaagaggaaaaagagagtattatgacattaattcgaaaacgtgcc
tctgattcttccttttga

DBGET integrated database retrieval system