KEGG   Neisseria lactamica: NLA_10720Help
Entry
NLA_10720         CDS       T01368                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nla  Neisseria lactamica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NLA_10720 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NLA_10720 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NLA_10720 (thrC)
Enzymes [BR:nla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NLA_10720 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136895..1138352
Genome map
AA seq 485 aa AA seqDB search
MPSEAVFLQFRQTRKIMKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLD
KWRGLSYPELAFEIMRLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQAL
SNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFML
SPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSIN
WGRIVAQVVYYFAGYFKATQSNDEQVSFCVPSGNFGNVCAGHIAKQMGLPVRRLIVATNE
NDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWAEVT
AGKGFDLRFALDKVGGKYGFTSGKSIHADRLATIKQVYEQNQELIDPHTADGVKVAREVR
EEGETVVCLETALAAKFDATIREAVGDVAIPRPAALEGLEKLPQRVQTVPNSADAVKGII
EQTLA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagccgtttttctgcaatttcgacagacgagaaaaatcatgaaatacatc
agcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattgatggggcttgca
cccgacggcggtctgatgctgccggaacattatccgcaaatcgggcgcgaaaccttggac
aaatggcgcggtttgtcttatcccgaattggcgtttgaaattatgcgcctgttcgttacg
gatattccggaggacgatttgcgcgacattctgaaccgtacttacacggaagcggcgttc
ggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaaatccaagccttg
tccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttgggcaatgcgttt
gaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcaaccagcggcgat
acgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaacgtatttatgctg
tcgcccgacggtaaaatgagcgcgttccaacgtgcgcagatgtacagcctgcaagacgga
aatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggacattgtgaaggca
gtgcaaaacgatgccgcgttcaaggaaaaataccatatcggtacggtcaactcgattaac
tggggacgcatcgtcgcgcaagtggtttattactttgcgggctatttcaaagcgacgcaa
agcaatgacgagcaagtcagcttctgcgtgccgagcggtaacttcggcaatgtttgcgcg
ggacacatcgccaaacaaatgggtctgcctgtccgccgcctgattgtcgcgaccaatgaa
aacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgcaacagcgcgcat
acttatgttacctccagcccgtcgatggacatttccaaagcgtccaacttcgagcgtttc
gtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgggcggaagtcacg
gcgggtaagggctttgacctgcgatttgccttggacaaagtcggcggcaaatacggcttt
acctccggcaaatccatccacgccgaccgcctcgccaccatcaagcaggtttacgagcaa
aaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcccgcgaagtgcgt
gaagaaggggaaacggtggtttgtttggaaaccgcgttggcggcgaaattcgatgcgacc
atacgcgaagccgtcggcgatgtcgccattccgcgccccgccgcgctggaaggtttggaa
aaattgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggtaaaaggcatcatc
gaacaaacccttgcctga

DBGET integrated database retrieval system