KEGG   Neisseria lactamica: NLA_13110Help
Entry
NLA_13110         CDS       T01368                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nla  Neisseria lactamica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NLA_13110 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NLA_13110 (sdhD)
   00650 Butanoate metabolism
    NLA_13110 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NLA_13110 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1448818..1449144)
Genome map
AA seq 108 aa AA seqDB search
MTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFTLPKEYSAWQAFFSQTWVKVFTQVSFL
AVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLAGCLVYSVKVIWG
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggcgcccattacggtttgcgcgattgggcaatgcagcgtgcgactgcggttatt
atgttgatttataccgttgcacttttggtggttctgtttaccctgcctaaagaatattcg
gcgtggcaggcattttttagtcaaacttgggtaaaagtgtttacccaggtgagctttttg
gcagtattcctgcatgcatgggtaggtatccgcgacttgtggatggactatatcaaaccc
ttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctggccggctgcctggtg
tattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system