KEGG   Neisseria lactamica: NLA_13110Help
Entry
NLA_13110         CDS       T01368                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nla  Neisseria lactamica
Pathway
nla00020  Citrate cycle (TCA cycle)
nla00190  Oxidative phosphorylation
nla00650  Butanoate metabolism
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01120  Microbial metabolism in diverse environments
nla01130  Biosynthesis of antibiotics
nla01200  Carbon metabolism
Module
nla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nla_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NLA_13110 (sdhD)
   00650 Butanoate metabolism
    NLA_13110 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NLA_13110 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: CBN87531
UniProt: E4ZDU7
Position
complement(1448818..1449144)
Genome map
AA seq 108 aa AA seqDB search
MTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFTLPKEYSAWQAFFSQTWVKVFTQVSFL
AVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLAGCLVYSVKVIWG
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggcgcccattacggtttgcgcgattgggcaatgcagcgtgcgactgcggttatt
atgttgatttataccgttgcacttttggtggttctgtttaccctgcctaaagaatattcg
gcgtggcaggcattttttagtcaaacttgggtaaaagtgtttacccaggtgagctttttg
gcagtattcctgcatgcatgggtaggtatccgcgacttgtggatggactatatcaaaccc
ttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctggccggctgcctggtg
tattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system