KEGG   Neisseria lactamica: NLA_14670Help
Entry
NLA_14670         CDS       T01368                                 

Gene name
cysK
Definition
(GenBank) putative cysteine synthase
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
nla  Neisseria lactamica
Pathway
nla00270  Cysteine and methionine metabolism
nla00920  Sulfur metabolism
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01120  Microbial metabolism in diverse environments
nla01130  Biosynthesis of antibiotics
nla01200  Carbon metabolism
nla01230  Biosynthesis of amino acids
Module
nla_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NLA_14670 (cysK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NLA_14670 (cysK)
Enzymes [BR:nla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     NLA_14670 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ADH_zinc_N Pribosyltran PRMT5
Motif
Other DBs
NCBI-ProteinID: CBN87681
UniProt: E4ZE96
Position
complement(1597711..1598697)
Genome map
AA seq 328 aa AA seqDB search
MPMEIAPYCRNLIIQEQKMKIANSITELIGNTPLVKLNRLTEGLKAEVAVKLEFFNPGSS
VKDRIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCAARGYKLAITMPESMSKER
KMLLRAFGAELILTPAAEGMAGAIAKAQSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEE
IWRDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEVKVVAVEPEASPVLSGGEKGPHPIQ
GIGAGFIPTVLNTKIYDSIAKVPNEAAFETARAMAEKEGILVGISSGAAVWSALQLAKQP
ENEGKLIVVLLPSYGERYLSTPLFADLA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggagattgcgccttactgtcgaaaccttattattcaggagcagaagatgaaa
attgcaaacagcatcaccgaattgatcggcaacacccccttggtcaaattgaaccgcctg
accgaaggactgaaggcggaagttgccgtgaagctggaatttttcaatccgggcagcagc
gtgaaagaccgcattgccgaagcaatgatcgaggctgccgagaaagcgggcaaaatcaac
aaaaacaccgtcattgttgaggcaaccagcggcaatacgggtatcggtttggcgatggta
tgtgcggcacgcggctacaaattggcgattaccatgccggaaagcatgagcaaagagcgc
aaaatgctgttgcgcgcgtttggtgcggagctgattctgacacctgccgccgaaggtatg
gcgggcgcgattgccaaagcgcaatccttggtggacgcgcatccagacacttattttatg
ccgcgccagttcgacaatgaggcaaaccccgaagtccaccgcaaaacaaccgccgaggaa
atttggcgggatacggacggcaaagtcgatgtctttgttgccggtgtcggcacaggtggt
acgattaccggcgtgggcgaagtattgaaaaaatacaaacccgaagttaaagtggttgcc
gtcgagcctgaggcttcccccgtattgagcggcggcgaaaaaggcccgcacccgattcaa
ggtatcggcgcaggctttattccgaccgttttgaataccaaaatctacgacagtattgcc
aaagtgccgaacgaagcggcttttgaaaccgcccgcgcaatggcggaaaaagaaggcatt
ttggtgggtatttcttccggtgcggcagtttggagcgcgttgcagcttgccaaacagcct
gaaaacgaaggcaagctgatagtcgtgctgctgccttcttatggcgaacgctatctctct
acgccactttttgcagatttggcataa

DBGET integrated database retrieval system