KEGG   Neisseria lactamica: NLA_14670Help
Entry
NLA_14670         CDS       T01368                                 

Gene name
cysK
Definition
cysteine synthase (EC:2.5.1.47)
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
nla  Neisseria lactamica
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NLA_14670 (cysK)
   01230 Biosynthesis of amino acids
    NLA_14670 (cysK)
  Energy metabolism
   00920 Sulfur metabolism
    NLA_14670 (cysK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NLA_14670 (cysK)
Enzymes [BR:nla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     NLA_14670 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1597711..1598697)
Genome map
AA seq 328 aa AA seqDB search
MPMEIAPYCRNLIIQEQKMKIANSITELIGNTPLVKLNRLTEGLKAEVAVKLEFFNPGSS
VKDRIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCAARGYKLAITMPESMSKER
KMLLRAFGAELILTPAAEGMAGAIAKAQSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEE
IWRDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEVKVVAVEPEASPVLSGGEKGPHPIQ
GIGAGFIPTVLNTKIYDSIAKVPNEAAFETARAMAEKEGILVGISSGAAVWSALQLAKQP
ENEGKLIVVLLPSYGERYLSTPLFADLA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggagattgcgccttactgtcgaaaccttattattcaggagcagaagatgaaa
attgcaaacagcatcaccgaattgatcggcaacacccccttggtcaaattgaaccgcctg
accgaaggactgaaggcggaagttgccgtgaagctggaatttttcaatccgggcagcagc
gtgaaagaccgcattgccgaagcaatgatcgaggctgccgagaaagcgggcaaaatcaac
aaaaacaccgtcattgttgaggcaaccagcggcaatacgggtatcggtttggcgatggta
tgtgcggcacgcggctacaaattggcgattaccatgccggaaagcatgagcaaagagcgc
aaaatgctgttgcgcgcgtttggtgcggagctgattctgacacctgccgccgaaggtatg
gcgggcgcgattgccaaagcgcaatccttggtggacgcgcatccagacacttattttatg
ccgcgccagttcgacaatgaggcaaaccccgaagtccaccgcaaaacaaccgccgaggaa
atttggcgggatacggacggcaaagtcgatgtctttgttgccggtgtcggcacaggtggt
acgattaccggcgtgggcgaagtattgaaaaaatacaaacccgaagttaaagtggttgcc
gtcgagcctgaggcttcccccgtattgagcggcggcgaaaaaggcccgcacccgattcaa
ggtatcggcgcaggctttattccgaccgttttgaataccaaaatctacgacagtattgcc
aaagtgccgaacgaagcggcttttgaaaccgcccgcgcaatggcggaaaaagaaggcatt
ttggtgggtatttcttccggtgcggcagtttggagcgcgttgcagcttgccaaacagcct
gaaaacgaaggcaagctgatagtcgtgctgctgccttcttatggcgaacgctatctctct
acgccactttttgcagatttggcataa

DBGET integrated database retrieval system