KEGG   Neisseria lactamica: NLA_14670Help
Entry
NLA_14670         CDS       T01368                                 

Gene name
cysK
Definition
cysteine synthase (EC:2.5.1.47)
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
nla  Neisseria lactamica
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NLA_14670 (cysK)
   01230 Biosynthesis of amino acids
    NLA_14670 (cysK)
  Energy metabolism
   00920 Sulfur metabolism
    NLA_14670 (cysK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NLA_14670 (cysK)
Enzymes [BR:nla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     NLA_14670 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1597711..1598697)
Genome map
AA seq 328 aa AA seqDB search
MPMEIAPYCRNLIIQEQKMKIANSITELIGNTPLVKLNRLTEGLKAEVAVKLEFFNPGSS
VKDRIAEAMIEAAEKAGKINKNTVIVEATSGNTGIGLAMVCAARGYKLAITMPESMSKER
KMLLRAFGAELILTPAAEGMAGAIAKAQSLVDAHPDTYFMPRQFDNEANPEVHRKTTAEE
IWRDTDGKVDVFVAGVGTGGTITGVGEVLKKYKPEVKVVAVEPEASPVLSGGEKGPHPIQ
GIGAGFIPTVLNTKIYDSIAKVPNEAAFETARAMAEKEGILVGISSGAAVWSALQLAKQP
ENEGKLIVVLLPSYGERYLSTPLFADLA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggagattgcgccttactgtcgaaaccttattattcaggagcagaagatgaaa
attgcaaacagcatcaccgaattgatcggcaacacccccttggtcaaattgaaccgcctg
accgaaggactgaaggcggaagttgccgtgaagctggaatttttcaatccgggcagcagc
gtgaaagaccgcattgccgaagcaatgatcgaggctgccgagaaagcgggcaaaatcaac
aaaaacaccgtcattgttgaggcaaccagcggcaatacgggtatcggtttggcgatggta
tgtgcggcacgcggctacaaattggcgattaccatgccggaaagcatgagcaaagagcgc
aaaatgctgttgcgcgcgtttggtgcggagctgattctgacacctgccgccgaaggtatg
gcgggcgcgattgccaaagcgcaatccttggtggacgcgcatccagacacttattttatg
ccgcgccagttcgacaatgaggcaaaccccgaagtccaccgcaaaacaaccgccgaggaa
atttggcgggatacggacggcaaagtcgatgtctttgttgccggtgtcggcacaggtggt
acgattaccggcgtgggcgaagtattgaaaaaatacaaacccgaagttaaagtggttgcc
gtcgagcctgaggcttcccccgtattgagcggcggcgaaaaaggcccgcacccgattcaa
ggtatcggcgcaggctttattccgaccgttttgaataccaaaatctacgacagtattgcc
aaagtgccgaacgaagcggcttttgaaaccgcccgcgcaatggcggaaaaagaaggcatt
ttggtgggtatttcttccggtgcggcagtttggagcgcgttgcagcttgccaaacagcct
gaaaacgaaggcaagctgatagtcgtgctgctgccttcttatggcgaacgctatctctct
acgccactttttgcagatttggcataa

DBGET integrated database retrieval system