KEGG   Neisseria lactamica: NLA_15340Help
Entry
NLA_15340         CDS       T01368                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nla  Neisseria lactamica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NLA_15340 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NLA_15340 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NLA_15340 (trpB)
Enzymes [BR:nla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NLA_15340 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1654837..1656039)
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLYVSETLIPALQELADAYKAAKNDPEFWAEFHRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVSVESGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKEQMLEAIGRQPDVAVACVGGGS
NAIGLFHPYIEEENVRLVGVEAGGLGVDTPDHAAPITSKAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNVPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgagaagggctttttcggcgaacatggcgggctttat
gtctccgaaaccctgattcccgccttgcaagagctggcggatgcctataaggcagcgaaa
aacgatcctgaattttgggcagagttccaccgcgatttgaaacattatgtcggcaggccc
agtcccgtttatcacgccgcgcggttgtccgaacatctgggcggcgcgcaaatctggttg
aaacgcgaagatttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ttgctcgcccgccgtatgggtaaaaaacgcgtgattgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcacgcttcggaatgacttgcgacgtgtatatgggt
gcggacgacatccaacgccaaatgcccaacgtgttccgcatgaaattgttgggcgcgaac
gtggttagcgtagaaagcggcagccgcacgctgaaagacgcgatgaacgaagcgatgcgc
gaatgggtcgcccgcgtggacgacacgttctacatcatcggcaccgccgccggtcccgca
ccgtatcccgaaatggtgcgcgatttccaatgcgtcatcggcaacgaagccaaagaacaa
atgttggaagccatcggtcgccaacctgatgttgccgttgcctgcgtgggcggcggctcc
aatgccatcggtttgttccatccctatatcgaagaagaaaacgtgcgtttggtcggcgta
gaagccggcggtttgggcgtggatacccccgaccacgccgcgccgattaccagcaaagcc
cccatcggcgtattgcacggcttccgcagctatctgatgcaggacgaaaacggccaggtt
ttggggacgcactccgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacaccgttgccaaagatgatgaagcacttgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaatgtgccgaaaatgggtaaagaccaagtgattctggtcaac
ctgtccggccgcggcgacaaagacatcaataccgtggcgaagctcaaaggtattaaactg
taa

DBGET integrated database retrieval system