KEGG   Neisseria lactamica: NLA_15640Help
Entry
NLA_15640         CDS       T01368                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nla  Neisseria lactamica
Pathway
nla00260  Glycine, serine and threonine metabolism
nla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01130  Biosynthesis of antibiotics
nla01230  Biosynthesis of amino acids
Module
nla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NLA_15640 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NLA_15640 (trpA)
Enzymes [BR:nla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NLA_15640 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF3854
Motif
Other DBs
NCBI-ProteinID: CBN87773
UniProt: E4ZEI7
Position
complement(1683498..1684283)
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYITVGDPDIGATLAIMHSMVANGADILELGVPFSDPMADGP
VIQRAAERALANGVSLRDVLDVVRKFRETDTQTPVVLMGYLNPIHKMGYREFAQEAAKAG
VDGVLTVDSPIETIDSLYRELKGNGVDCIFLIAPTTTEGRIKTIAQFAGGFVYYVSLKGV
TGAASLDTDEVSSRIEYLRQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIEN
NTGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccttat
attacggttggagacccggatattggggcgactttggcaataatgcacagtatggttgca
aacggtgcggatattttagagttgggcgtgccgttttccgatccgatggcggacgggccg
gtgattcagcgtgcggcggaacgggcgttggcaaacggtgtttccctgcgcgatgtcttg
gatgttgtcaggaagtttcgtgaaaccgacacgcaaacgccggttgttttgatggggtat
ttgaaccccatacataagatgggttatcgggagtttgcacaagaggccgcaaaggcgggc
gtggacggcgtgttgacggtggattcccccatcgaaaccatcgattctttatatcgcgag
ctgaaaggcaacggggttgactgtattttcctgattgcacctacaacgaccgaagggcgc
attaagaccattgcacaatttgccggcggttttgtttattatgtatcgctcaaaggggta
acgggtgcggcaagtttggatacggatgaagtttcgagtagaatagagtatttgcgtcag
tatattgatattcccatcggtgtcgggttcggcatcagtaatgcggaaagcgcgcgcaaa
atcggccgggttgccgacgcggtcattgtcggcagccggattgtgaaagaaatcgaaaac
aatacgggcaacgaggctgcggccgtcggtgctttggtgaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system