KEGG   Neisseria lactamica: NLA_16550Help
Entry
NLA_16550         CDS       T01368                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
nla  Neisseria lactamica
Pathway
nla00910  Nitrogen metabolism
nla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NLA_16550
Enzymes [BR:nla01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     NLA_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 TAT_signal Peptidase_A4
Motif
Other DBs
NCBI-ProteinID: CBN87860
UniProt: E4ZES4
Position
complement(1770068..1772035)
Genome map
AA seq 655 aa AA seqDB search
MSDEKLEQNGLSRRSFLGTAAASGAGIAGAGLLGLAGCSKNGEPAAANASGAAPVAKAQG
ESKPGQLSSEVGPGELDQYYGFLSGGQSGEMRLIGLPSMRELMRIPVFNMDSATGWGRTN
ESLKVLNGNITEETRKFLKDSGLRCYPNGDLHHPHLSFTDQTYDGRYAYANDKANNRVCR
VRLDVMKADKIIDIPNASGIHGLRPQRYPKTGYVFANGEHITPVSGVGKLDDAKTWNAVY
TAIDGETMEIAWQVLVDGNLDNGDADYQGKYSFATCYNSERALTVQGASSNEQDWCVVFD
LKAIEEGIKAGDFKEVNGVKMLDGRAEAKSKYTRYIPVPNSPHGCNASPDGKYIMLNGKL
SPTVTVLDVSKLDDLFAGKIKERDVVVAEPQLGLGPLHTAFDGRGNAYTTLFIDSQMVKW
NIDDAIKAYKGDKVDPIKQKLDVHYQPGHNHTTMGETKEADGQWLVSLNKFSKDRFLNAG
PLKPECDQLIDISGDEMRLVHDNPTFAEPHDLCLVAASKLNPGKTWDRKDPWFWQDALEQ
AKKDGVELEKAAKVVREGNKVRVYMTAVAPAYSIPQFEVNQGDEVTVYVTNVETIEDLTH
GFTLEGYGIAMEIGPQATSSVTFKAVRPGVHWYYCQWFCHALHMEMSGQMIVHPK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgaaaaattagaacaaaacggcttgagccgtcgttcattcttaggtacggcc
gccgcttccggtgcaggtattgccggtgcgggcctgttgggtttggcgggttgctctaaa
aacggcgaaccggctgccgctaacgcttccggagcggctcccgtcgccaaggcgcaaggg
gaatccaaaccgggccaactgtcttccgaagtcggtccgggcgaactcgatcaatattac
ggtttcctttccggcggccagtccggcgagatgcgcctgatcggcctgccttctatgcgc
gaactgatgcgtatccccgtgttcaatatggacagcgcgaccggttggggacgtaccaat
gagagtttgaaagtcctcaacggcaatattaccgaagaaacccgtaaatttttaaaagac
agcggcctgcgctgctaccccaacggcgaccttcaccacccgcacctgtcgtttaccgac
caaacttacgacggccgctatgcctatgccaacgataaggcaaacaaccgcgtctgccgc
gtgcgtctggatgtgatgaaggccgacaaaattatcgacatccccaatgcctcgggtatc
cacggcctgcgtccgcaacgttatccgaaaaccggttatgtctttgccaacggcgaacac
attacccctgtcagcggtgtaggcaaactggatgatgcgaaaacctggaatgccgtttat
accgccatcgacggcgaaaccatggaaatcgcatggcaggtattggttgacggcaacttg
gacaacggcgatgccgactaccaaggcaaatattcttttgccacctgctacaactccgag
cgcgcgctgaccgtgcaaggtgcgtcttccaacgagcaggactggtgcgtcgttttcgac
ttgaaagccatcgaggaaggcatcaaagcgggcgacttcaaagaagtgaacggcgtgaaa
atgctggacggccgcgctgaagccaaatccaaatacacgcgttatatccctgtgccgaac
tctccgcacggctgtaacgcaagccccgacggcaaatacattatgctcaacggcaagctg
tctccgaccgttaccgtattggatgtcagcaagctggacgatttgttcgccggcaaaatc
aaagagcgcgatgtggtcgtagccgaaccgcaactgggtctcggtcccttacacactgca
tttgacggtcgcggtaatgcttatacgacattgtttatcgacagccaaatggtgaaatgg
aatatcgacgacgcaatcaaagcctacaaaggcgacaaagtcgatccgatcaaacaaaaa
ctcgacgttcactaccaaccgggccacaaccatacgactatgggcgaaaccaaagaagcc
gacggccaatggctggtgtctttgaacaagttttctaaagaccgcttcctgaatgccggc
ccgttgaaacccgagtgcgaccaattgatcgacatctccggcgacgaaatgcgtctggta
cacgataatccgacttttgccgaaccgcacgacttgtgcttggttgccgcgtctaaattg
aacccgggcaaaacttgggaccgcaaagatccgtggttctggcaggatgctttggaacag
gcgaaaaaagacggtgtcgagctggaaaaagccgccaaagtcgtacgcgaaggcaacaaa
gtacgcgtgtatatgacggccgtcgcgcctgcttacagtatcccgcaatttgaagtgaac
caaggcgacgaagtaaccgtatacgttaccaacgtcgaaaccatcgaggatttgacccac
ggtttcactttggaaggctacggcatcgctatggaaatcggtccgcaagccacttcttcc
gtaaccttcaaagccgtccgtccgggcgtgcactggtactactgccaatggttctgccac
gccttgcacatggaaatgtccggtcagatgattgttcatcccaaataa

DBGET integrated database retrieval system