KEGG   Neisseria lactamica: NLA_16890Help
Entry
NLA_16890         CDS       T01368                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nla  Neisseria lactamica
Brite
Enzymes [BR:nla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NLA_16890
Secretion system [BR:nla02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NLA_16890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807805..1808587
Genome map
AA seq 260 aa AA seqDB search
MKTKLIKILTPLTVLPLLACGQTPVSNANAEPAAKAESAGKSVAASLKARLEKIYSAQDL
KVLSVSETPVKGIYEVVVSGRQIIYTDANADYLFSGELIDINNRKNLTEQRMADLNKIDF
ASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCRRLEHEFEKMTDVTVYSFMMPIAGLHPDA
ARKAQILWCQPDRAKAWTEWMRKGKFPAGGGICDNPVAETTSLGEQFGFNGTPTLVFPNG
RSQSGYSPMPQLEEIIRKNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaatcaaaatcttaaccccccttaccgtcctcccgctgctggcgtgc
ggtcaaaccccagtttccaatgccaacgccgaacccgccgccaaagccgagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaatctattccgcccaagatttg
aaagtgttgagcgtcagcgaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggc
aggcagattatctacaccgatgcaaacgccgattatctattttccggcgaacttattgac
atcaacaaccggaaaaacctcaccgaacagcgtatggcagatttgaacaaaatcgacttc
gcctccctgcctttggacaaagccatcaaagaagtacgcggcaacggcaaactgaaagtc
gccgtattctccgaccccgactgcccgttctgcagacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccccgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggaatgg
atgcgtaaaggcaaattcccggccggcggcggcatctgcgacaaccccgtcgcggaaacc
acttccttgggcgaacagttcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system