KEGG   Neisseria lactamica: NLA_16930Help
Entry
NLA_16930         CDS       T01368                                 

Gene name
adhA
Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nla  Neisseria lactamica
Pathway
nla00010  Glycolysis / Gluconeogenesis
nla00071  Fatty acid degradation
nla00350  Tyrosine metabolism
nla00625  Chloroalkane and chloroalkene degradation
nla00626  Naphthalene degradation
nla01100  Metabolic pathways
nla01110  Biosynthesis of secondary metabolites
nla01120  Microbial metabolism in diverse environments
nla01130  Biosynthesis of antibiotics
nla01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NLA_16930 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NLA_16930 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NLA_16930 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NLA_16930 (adhA)
   00626 Naphthalene degradation
    NLA_16930 (adhA)
Enzymes [BR:nla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NLA_16930 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 DUF2237 CoA_binding Methyltransf_25 MTS
Motif
Other DBs
NCBI-ProteinID: CBN87898
UniProt: E4ZEW2
Position
1812827..1813873
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEVVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATHCIVNADYAVKVPDGLDPAQASSITCAGVTCYKAIKVSGVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAVDVNDEKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTA
VSAAAFNSAVDCVRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggagatgtggaagtagtcgaa
cgcgaggttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgttg
ggacacgagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccctgtgccgttccgtattgaacgcgggctacaccgcagacggcggt
atggcgacccactgcatcgtcaatgcggactacgccgtcaaagtccccgacggtctcgac
cccgcccaagcgtccagcatcacttgcgccggcgttacctgctacaaagccattaaagtt
tccggcgtgcgtccgggacagtggattgcaatttacggcgcgggcggtttgggcaacctg
ggtgtccaatacgcgaaaaaagtgttcggcgcgcacgtcgtcgccgttgatgtcaacgat
gaaaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgcc
gtatctgccgccgcattcaactctgccgtggattgcgtccgcgcgggcggacgtgtggtt
gccgtcgggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggc
atcgaagtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattc
ggcgcggaaggtttggttgtgcccaaagtccaactgcgtgctttggacgaagcacccgcc
attttccaagaaatgcgcgaaggcaaaatcaccggccgtatggtgatcgatatgaaaaaa
gaatgcggctgcggccaccaccactga

DBGET integrated database retrieval system