KEGG   Neisseria lactamica: NLA_16930Help
Entry
NLA_16930         CDS       T01368                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nla  Neisseria lactamica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NLA_16930 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NLA_16930 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NLA_16930 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NLA_16930 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NLA_16930 (adhA)
   00626 Naphthalene degradation
    NLA_16930 (adhA)
Enzymes [BR:nla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NLA_16930 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1812827..1813873
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEVVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATHCIVNADYAVKVPDGLDPAQASSITCAGVTCYKAIKVSGVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAVDVNDEKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTA
VSAAAFNSAVDCVRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggagatgtggaagtagtcgaa
cgcgaggttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgttg
ggacacgagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccctgtgccgttccgtattgaacgcgggctacaccgcagacggcggt
atggcgacccactgcatcgtcaatgcggactacgccgtcaaagtccccgacggtctcgac
cccgcccaagcgtccagcatcacttgcgccggcgttacctgctacaaagccattaaagtt
tccggcgtgcgtccgggacagtggattgcaatttacggcgcgggcggtttgggcaacctg
ggtgtccaatacgcgaaaaaagtgttcggcgcgcacgtcgtcgccgttgatgtcaacgat
gaaaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgcc
gtatctgccgccgcattcaactctgccgtggattgcgtccgcgcgggcggacgtgtggtt
gccgtcgggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggc
atcgaagtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattc
ggcgcggaaggtttggttgtgcccaaagtccaactgcgtgctttggacgaagcacccgcc
attttccaagaaatgcgcgaaggcaaaatcaccggccgtatggtgatcgatatgaaaaaa
gaatgcggctgcggccaccaccactga

DBGET integrated database retrieval system