KEGG   Neisseria lactamica: NLA_18260Help
Entry
NLA_18260         CDS       T01368                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nla  Neisseria lactamica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NLA_18260 (tpi)
   01230 Biosynthesis of amino acids
    NLA_18260 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NLA_18260 (tpi)
   00051 Fructose and mannose metabolism
    NLA_18260 (tpi)
   00562 Inositol phosphate metabolism
    NLA_18260 (tpi)
Enzymes [BR:nla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NLA_18260 (tpi)
Exosome [BR:nla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NLA_18260 (tpi)
  Exosomal proteins of bladder cancer cells
   NLA_18260 (tpi)
  Exosomal proteins of melanoma cells
   NLA_18260 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962544..1963317
Genome map
AA seq 257 aa AA seqDB search
MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRIHPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPNNGAYTGEVSAEMLADIGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVKQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccaaaacaacaacgcactgatgcaccgcttccgcatccaccccaccgccgaa
cgcgtcctcatcgggctcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgttttaaacaaccgcatccttacctgcgcccaagacgtgagccgttttccgaat
aacggcgcgtacaccggcgaagtatccgccgaaatgctcgccgacatcggaacagacatc
gtcctcatcggacactccgaacgcagcctctatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactgattccgttattgtgcgtcggcgaaagc
ctcgaggagcgcgaagccggcaaagaacacgaagtcatcgcccaccaactctccatattg
caagggctggacaccaaaaacatcgccgtcgcctacgagccggtttgggcaatcggcacc
ggcaaagtcgccaccgtaaaacaaatcgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaggcg
gacaacgcggccgacatcttcgcagtgccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcttttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system