KEGG   Neisseria lactamica: NLA_18260Help
Entry
NLA_18260         CDS       T01368                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nla  Neisseria lactamica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NLA_18260 (tpi)
   01230 Biosynthesis of amino acids
    NLA_18260 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NLA_18260 (tpi)
   00051 Fructose and mannose metabolism
    NLA_18260 (tpi)
   00562 Inositol phosphate metabolism
    NLA_18260 (tpi)
Enzymes [BR:nla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NLA_18260 (tpi)
Exosome [BR:nla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NLA_18260 (tpi)
  Exosomal proteins of bladder cancer cells
   NLA_18260 (tpi)
  Exosomal proteins of melanoma cells
   NLA_18260 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962544..1963317
Genome map
AA seq 257 aa AA seqDB search
MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRIHPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPNNGAYTGEVSAEMLADIGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVKQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccaaaacaacaacgcactgatgcaccgcttccgcatccaccccaccgccgaa
cgcgtcctcatcgggctcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgttttaaacaaccgcatccttacctgcgcccaagacgtgagccgttttccgaat
aacggcgcgtacaccggcgaagtatccgccgaaatgctcgccgacatcggaacagacatc
gtcctcatcggacactccgaacgcagcctctatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactgattccgttattgtgcgtcggcgaaagc
ctcgaggagcgcgaagccggcaaagaacacgaagtcatcgcccaccaactctccatattg
caagggctggacaccaaaaacatcgccgtcgcctacgagccggtttgggcaatcggcacc
ggcaaagtcgccaccgtaaaacaaatcgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaggcg
gacaacgcggccgacatcttcgcagtgccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcttttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system