KEGG   Neisseria lactamica: NLA_18690Help
Entry
NLA_18690         CDS       T01368                                 

Definition
Inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nla  Neisseria lactamica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NLA_18690
Enzymes [BR:nla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NLA_18690
Transfer RNA biogenesis [BR:nla03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NLA_18690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2001136..2001930)
Genome map
AA seq 264 aa AA seqDB search
MLHRLQKVVRHIAQTEIMPRFLNTPSCRKEDGSMLSEADIAAQTAFAAALPLLIDCPMLG
EEMSRQEQSALWEQYSGEKGLWIVDPIDGTNNFVNGLPHFAVSVAFVRNGRAELGVIYNP
VSGECFYAERGQGAFLNGTRLPLRLVDKKLNEAIAGVEIKYLRSGKLSSRMSTLAPFGTV
RSMGSSTLDWCYLACGRYDVYVHGGQKLWDYAAGALIFEEAGGRLTTLEGDGFWSGEHVF
KRSVVAALEPKLFERWVGWIRENQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcaccgtttgcagaaagtcgtgcgccatattgcgcaaaccgaaattatgccgcgt
tttttgaatacgccgtcttgccgcaaggaagacggttcgatgttgagcgaggcggacatt
gccgcgcagacggcttttgccgccgcgttgccgcttctgatcgattgcccgatgttgggc
gaggaaatgtcgcggcaggaacagtcggctttgtgggaacaatattcgggggaaaagggg
ctgtggattgtcgatccgatagacgggacaaataattttgtcaacgggctgccgcatttt
gcggtatcggtggcgtttgtccgcaacgggcgcgccgagttgggcgtaatctacaacccg
gtcagcggcgaatgtttttatgccgaacgcgggcagggggcgtttttaaacgggacgcgc
ctgcccctgcgcctcgtggataaaaaactcaatgaggcaatcgcgggcgtggaaatcaaa
tatctgcgttccggcaaactttccagccgtatgagtacgctcgcgcctttcgggacggtg
cggagtatgggcagcagtacgctggactggtgttatctggcctgcggacgctatgatgtt
tatgtccacggagggcagaagctgtgggactatgctgcgggtgcgttgattttcgaggag
gcgggcggcaggctgacgactttggaaggcgacgggttttggagtggtgaacacgtgttc
aaacgctcggtcgtcgccgcgctcgaaccgaagctgtttgaacgctgggtcgggtggata
cgggaaaaccaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system