KEGG   Neisseria lactamica: NLA_19990Help
Entry
NLA_19990         CDS       T01368                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nla  Neisseria lactamica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nla03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2147462..2148046
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFCNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAAPSENDETNDIVGTLLALGYSEREAKAAVKGVPKGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaggctgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggctatgaagccgacgtatcgatgcagaccttctgcaacctgccgccc
gtgggcgaaagcgtacaactgtttacccaacttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaagaccttccgccaactgatcaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcgg
gcagtggcggaagaagatgtcaaacgcctctcctccgctccgggaatcggcaaaaaaacc
gccgaacgcatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgccccgtccgagaatgacgaaaccaacgacatcgtcggcacgctcctcgcc
ctcggttacagcgaacgcgaagcgaaagcggcggtcaaaggcgttccgaaggggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system